CF835372

Overview
NameCF835372
Unique NameCF835372
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length740
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5402 contig Csv1_Contig5402:39..778. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GSTF_HYOMU (Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 7.956e-71
Identity = 131/207 (63.29%), Postives = 158/207 (76.33%), Query Frame = 3
Query:   39 GIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 656
            G+K+HG   S A  RV A+L EK+L++ELVPV+M+AG+HKKE F++LNPFGQVP  E GD KLFESRAITQYIA  + DKG QL     K +A + VW EVE+ +FDP +SKL +E+V KPM GM TD AAV ENE KL K+LDVYE+RL  SKYL  DSFTL DLHH P +N L+GT VK LFD+RPHVSAW ADI +RPAW+K +
Sbjct:    2 GMKLHGPAMSPAVMRVIATLKEKDLDFELVPVNMQAGDHKKEPFITLNPFGQVPAFEDGDLKLFESRAITQYIAHTYADKGNQLLANDPKKMAIMSVWMEVESQKFDPVASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPAMNYLMGTKVKSLFDSRPHVSAWCADILARPAWSKAI 208          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GSTF6_ARATH (Glutathione S-transferase 6, chloroplastic OS=Arabidopsis thaliana GN=GST6 PE=1 SV=3)

HSP 1 Score: 265.388 bits (677), Expect = 2.315e-70
Identity = 136/214 (63.55%), Postives = 165/214 (77.10%), Query Frame = 3
Query:   33 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG--KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 668
            MA IKVHG   STAT RV A+LYEK+L++EL+PVDM+AG HK+EA L+LNPFGQ+P LE GD  LFESRAITQY+A+E+ +KG +L      K  A   VW +VE  QFDP +SKL +E V+K MFGMTTDPAAV+E E KL K+LDVYEARL++S++LA DSFTL DLHHLP I+ LLGT  K LFD+RP VS W   I++RPAWAKV+ L K
Sbjct:   49 MASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSRPKVSEWIKKISARPAWAKVIDLQK 262          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GSTF1_TOBAC (Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 6.735e-70
Identity = 131/210 (62.38%), Postives = 160/210 (76.19%), Query Frame = 3
Query:   42 IKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 668
            IKVHGS  STAT RV A L EKEL++E VPVDM +GEHKK  +LSLNPFGQVP  E GD KLFESRAITQYIA  + D G QL     K +  + VW EVE  +F+PP++KL WEL  KP+ GMTTD AAV+E+EA+L+K+LD+YE +L++SKYL  DSFTLVDLHH+PNI  L+ + VK++FD+RP VSAW ADI +RPAW K L  L+
Sbjct:    3 IKVHGSPMSTATMRVAACLIEKELDFEFVPVDMASGEHKKHPYLSLNPFGQVPAFEDGDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPSMSVWMEVEGQKFEPPATKLTWELGIKPIIGMTTDDAAVKESEAQLSKVLDIYETQLAESKYLGGDSFTLVDLHHIPNIYYLMSSKVKEVFDSRPRVSAWCADILARPAWVKGLEKLQ 212          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GSTF1_ARATH (Glutathione S-transferase 1 OS=Arabidopsis thaliana GN=GST1 PE=1 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 1.500e-69
Identity = 133/208 (63.94%), Postives = 156/208 (75.00%), Query Frame = 3
Query:   33 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 656
            MAGIKV G   STAT+RV  +L+EK +++E V V++K GEHKKE F+  NPFG+VP  E GD K+FESRAITQYIA EF DKG  L   GK +A + +  E+E+ +FDP  SKL WE V KP++GMTTD   VEE EAKLAK+LDVYE RL +SKYLA D FTLVDLH +P I  LLGTP KKLFD RPHVSAW ADITSRP+  KVL
Sbjct:    1 MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAQKVL 208          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GSTF2_TOBAC (Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.343e-69
Identity = 131/210 (62.38%), Postives = 158/210 (75.24%), Query Frame = 3
Query:   42 IKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLL-VWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 668
            IKVHGS  STAT RV A L EK+L++ELVPVDM +GEHKK  +LSLNPFGQVP  E GD KLFESRAITQYIA  + D G QL        P++ VW EVE  +F+P +SKL WEL  KP+ GMTTD  AV+E+E +L+K+LD+YE RL++SKYL  DSFTLVDLHH+PNI  L+ T VK++FD+RP VSAW ADI +RPAW K L  L+
Sbjct:    3 IKVHGSPMSTATMRVAACLIEKDLDFELVPVDMVSGEHKKHPYLSLNPFGQVPAFEDGDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPIMSVWMEVEGQKFEPHASKLTWELGIKPIIGMTTDDDAVKESEVQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSTKVKEVFDSRPRVSAWCADILARPAWVKGLEKLQ 212          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GSTF_SILCU (Glutathione S-transferase OS=Silene cucubalus GN=GST PE=1 SV=3)

HSP 1 Score: 258.84 bits (660), Expect = 2.167e-68
Identity = 136/213 (63.85%), Postives = 164/213 (77.00%), Query Frame = 3
Query:   42 IKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIA--QEFPDKGTQLTCPGK-PIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYL-ACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 668
            IKVHG+  STATQRV  +LYEK LE+E VP+DM AG HK+ ++L+LNPFGQVP LE G+ KLFESRAIT+Y+A   +  ++GT L    K  +A  LVW+EVEA QFDP +SKL WELV+K +FGM TD   VEENEAKLAK+LDVYEARL++S+YL A DSFTLVDLHHLP +  L+GT VKKLF+ R HVSAW   I +RP+W K LAL K
Sbjct:    3 IKVHGNPRSTATQRVLVALYEKHLEFEFVPIDMGAGGHKQPSYLALNPFGQVPALEDGEIKLFESRAITKYLAYTHDHQNEGTSLIHKEKHEMAAQLVWEEVEAHQFDPVASKLAWELVFKGIFGMQTDTTVVEENEAKLAKVLDVYEARLTESEYLGANDSFTLVDLHHLPLLGYLMGTQVKKLFEERAHVSAWCKKILARPSWEKTLALQK 215          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GST11_ARATH (Glutathione S-transferase 11 OS=Arabidopsis thaliana GN=GST11 PE=1 SV=3)

HSP 1 Score: 258.84 bits (660), Expect = 2.167e-68
Identity = 134/209 (64.11%), Postives = 156/209 (74.64%), Query Frame = 3
Query:   33 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 656
            MAGIKV G   STAT+RV  +L+EK L++E V +++K GEHKKE F+  NPFG+VP  E GD KLFESRAITQYIA  + DKG QL   G K IA + +  E+E+ +FDP  SKL WE V KP++GMTTD   VEE EAKLAK+LDVYE RL +SKYLA D FTLVDLH +P I  LLGTP KKLFD RPHVSAW ADITSRP+  KVL
Sbjct:    1 MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAKKVL 209          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GST16_ARATH (Glutathione S-transferase 16 OS=Arabidopsis thaliana GN=GST16 PE=1 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 7.975e-63
Identity = 128/212 (60.38%), Postives = 152/212 (71.70%), Query Frame = 3
Query:   33 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLT-CPGKPIAPLLVWK---EVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 656
            MAGIKV G   ST+T+RV  +L+EK L++ELV V++K GEHKKE FLS NPFGQVP  E GD KLFESRAITQYIA  + ++GT L     K IA   +     +VEA QFDP +SKL WE V+K  +G+ TD A V E EAKLAK+LDVYEARL + KYLA ++FTL DLHH+P I  LLGTP KKLF  RP V+ W A+IT RPA  KVL
Sbjct:    1 MAGIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVL 212          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GSTF4_ARATH (Glutathione S-transferase PM24 OS=Arabidopsis thaliana GN=PM24.1 PE=1 SV=3)

HSP 1 Score: 234.958 bits (598), Expect = 3.351e-61
Identity = 125/211 (59.24%), Postives = 152/211 (72.04%), Query Frame = 3
Query:   33 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLT-CPGKPI---APLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKV 653
            MAGIKV G   S AT+RV  +L+EK L++ELV V++K GEHKKE FLS NPFGQVP  E GD KLFESRAITQYIA  + ++GT L     K I   A + +  +VE  QFDP +SKL +E ++K ++G+TTD A V E EAKLAK+LDVYEARL + KYLA ++FTL DLHH+P I  LLGTP KKLF  RP V+ W A+IT RPA  KV
Sbjct:    1 MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKV 211          
BLAST of CF835372 vs. ExPASy Swiss-Prot
Match: GSTF3_MAIZE (Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4)

HSP 1 Score: 177.563 bits (449), Expect = 6.348e-44
Identity = 100/221 (45.25%), Postives = 135/221 (61.09%), Query Frame = 3
Query:   33 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKK-LFDARPHVSAWAADITSRPAWAKVLALLKH*TLCPLP 692
            MA +K++G   S    RV   L EK L++E+VPVD+  G HK+  FL+LNPFGQ+P L  GD+ LFESRAI +YIA ++  +GT L       A L VW EVE+  F P +S L ++L+ +P+ G   D A VE++  +LAK+LDVYEA L+++KYLA D FTL D +H     L    P +     ARPHV AW   I +RPA+ K +A +      PLP
Sbjct:    1 MAPLKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALVDGDEVLFESRAINRYIASKYASEGTDLLPATASAAKLEVWLEVESHHFHPNASPLVFQLLVRPLLGGAPDAAVVEKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHALLPALTSARPPRPGCVAARPHVKAWWEAIAARPAFQKTVAAI------PLP 215          
The following BLAST results are available for this feature:
BLAST of CF835372 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
GSTF_HYOMU7.956e-7163.29Glutathione S-transferase OS=Hyoscyamus muticus PE... [more]
GSTF6_ARATH2.315e-7063.55Glutathione S-transferase 6, chloroplastic OS=Arab... [more]
GSTF1_TOBAC6.735e-7062.38Glutathione S-transferase PARB OS=Nicotiana tabacu... [more]
GSTF1_ARATH1.500e-6963.94Glutathione S-transferase 1 OS=Arabidopsis thalian... [more]
GSTF2_TOBAC3.343e-6962.38Glutathione S-transferase APIC OS=Nicotiana tabacu... [more]
GSTF_SILCU2.167e-6863.85Glutathione S-transferase OS=Silene cucubalus GN=G... [more]
GST11_ARATH2.167e-6864.11Glutathione S-transferase 11 OS=Arabidopsis thalia... [more]
GST16_ARATH7.975e-6360.38Glutathione S-transferase 16 OS=Arabidopsis thalia... [more]
GSTF4_ARATH3.351e-6159.24Glutathione S-transferase PM24 OS=Arabidopsis thal... [more]
GSTF3_MAIZE6.348e-4445.25Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C03_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835372 ID=CF835372|Name=CF835372|organism=Citrus sinensis|type=EST|length=740bp
CAATAACAAGCGCAGTGAAGGAAGACCCAAAGATGGCAGGCATCAAGGTC
CACGGTTCTGTTTTCTCAACTGCTACGCAGCGAGTTTTCGCATCCCTCTA
CGAGAAGGAGCTCGAATACGAGCTTGTCCCCGTAGACATGAAGGCTGGTG
AACACAAAAAGGAGGCCTTCCTTTCTTTGAATCCATTCGGTCAAGTTCCG
GTGCTTGAACACGGCGACCAGAAGCTCTTCGAATCAAGGGCAATCACCCA
ATACATCGCCCAGGAGTTTCCAGACAAAGGCACCCAGTTAACATGCCCAG
GCAAGCCCATCGCCCCGTTATTGGTATGGAAGGAGGTGGAGGCACTCCAG
TTCGACCCCCCATCATCGAAGCTCAACTGGGAGCTCGTGTACAAGCCAAT
GTTTGGAATGACCACTGATCCAGCTGCGGTTGAAGAAAATGAAGCTAAGC
TTGCCAAAATTTTAGATGTTTACGAGGCCCGTTTGTCTCAGTCCAAATAC
TTGGCGTGCGACAGCTTCACCTTGGTCGATTTGCATCATCTCCCCAATAT
TAATTTGTTGTTGGGGACGCCTGTCAAGAAGCTGTTTGATGCACGCCCCC
ATGTTAGCGCATGGGCAGCTGATATCACTTCCAGACCGGCTTGGGCTAAG
GTCCTTGCCTTGCTCAAACACTGAACACTCTGCCCGCTACCTACTAGACG
TTAGTCGCTCCTCGGTGGTCACTTATCTTTTGTAATACCT
back to top