CF835375

Overview
NameCF835375
Unique NameCF835375
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length737
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3442 contig Csv1_Contig3442:3..739. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS4_SOLTU (40S ribosomal protein S4 OS=Solanum tuberosum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 1.620e-124
Identity = 211/228 (92.54%), Postives = 224/228 (98.25%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++++RNRLKYALTYREVI+ILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEE+KFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE NKI DFIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYREVISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTL 228          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS42_ARATH (40S ribosomal protein S4-2 OS=Arabidopsis thaliana GN=RPS4B PE=2 SV=4)

HSP 1 Score: 445.277 bits (1144), Expect = 1.620e-124
Identity = 210/228 (92.11%), Postives = 224/228 (98.25%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS++DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLEENKI +FIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TI
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTI 228          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS41_ARATH (40S ribosomal protein S4-1 OS=Arabidopsis thaliana GN=RPS4A PE=2 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 1.620e-124
Identity = 210/228 (92.11%), Postives = 224/228 (98.25%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS++DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLEENKI +FIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TI
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTI 228          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS4_MAIZE (40S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 8.039e-124
Identity = 208/228 (91.23%), Postives = 224/228 (98.25%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIL++RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RLLYDTKGRFRLH +RDE+AKFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIK+DLE NKI DFIKFDVGN+VMVTGGRN GRVG+IKNREKHKGSFETIH++D+LGH+FATR+GNVFTI
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTI 228          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS43_ARATH (40S ribosomal protein S4-3 OS=Arabidopsis thaliana GN=RPS4D PE=2 SV=2)

HSP 1 Score: 442.965 bits (1138), Expect = 8.039e-124
Identity = 209/228 (91.67%), Postives = 223/228 (97.81%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS++DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLE NKI +FIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TI
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTI 228          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS4_GOSHI (40S ribosomal protein S4 OS=Gossypium hirsutum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 8.889e-123
Identity = 210/228 (92.11%), Postives = 221/228 (96.93%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARGLKKHLKRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPLIL+LRNRLKYALTYREVIAILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRLLYDTKGRF LH++  +E KFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE NKI DFIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIH+QDA GHEFATRLGNVFTI
Sbjct:    1 MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI 228          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS4_ORYSJ (40S ribosomal protein S4 OS=Oryza sativa subsp. japonica GN=RPS4 PE=2 SV=3)

HSP 1 Score: 439.113 bits (1128), Expect = 1.161e-122
Identity = 207/228 (90.79%), Postives = 223/228 (97.81%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIL++RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RLLYDTKGRFRL S++DE+AKFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDP+IKANDTIK+DLE NKI DFIKFDVGN+VMVTGGRN GRVG+IKNREKHKGSFETIH++DALGH+FATRLGNVFTI
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTI 228          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS4_PRUAR (40S ribosomal protein S4 OS=Prunus armeniaca GN=RPS4 PE=2 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 6.592e-118
Identity = 205/228 (89.91%), Postives = 216/228 (94.74%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIL+LRNRLKYALTYREV++ILMQRH+LVDGK+     +     DVVSIPKTNENFRLLYDTKGRFRLHS+RDEE+KFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLE NKITDFIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIH+QDA GHEFATRLGNVFTI
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVVSILMQRHILVDGKIH----FCIRLSDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI 224          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS4_CRIGR (40S ribosomal protein S4 OS=Cricetulus griseus GN=RPS4 PE=2 SV=2)

HSP 1 Score: 342.043 bits (876), Expect = 1.931e-93
Identity = 161/228 (70.61%), Postives = 188/228 (82.46%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARG KKHLKR+ APKHWMLDKL G FAP+PS+GPHK RECLPLI+ LRNRLKYALT  EV  I MQR + +DGKVRTD TYPAGFMDV+SI KT ENFRL+YDTKGRF +H +  EEAK+KLCKVR +  G KGIP++ T+D RTIRYPDPLIK NDTI++DLE  KITDFIKFD GN+ MVTGG N GR+G+I NRE+H GSF+ +H++DA G+ FATRL N+F I
Sbjct:    1 MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITSEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVI 228          
BLAST of CF835375 vs. ExPASy Swiss-Prot
Match: RS4_BOVIN (40S ribosomal protein S4 OS=Bos taurus GN=RPS4 PE=2 SV=3)

HSP 1 Score: 341.658 bits (875), Expect = 2.522e-93
Identity = 161/228 (70.61%), Postives = 188/228 (82.46%), Query Frame = 3
Query:   54 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI 737
            MARG KKHLKR+ APKHWMLDKL G FAP+PS+GPHK RECLPLI+ LRNRLKYALT  EV  I MQR + +DGKVRTD TYPAGFMDV+SI KT ENFRL+YDTKGRF +H +  EEAK+KLCKVR +  G KGIP++ T+D RTIRYPDPLIK NDTI++DLE  KITDFIKFD GN+ MVTGG N GR+G+I NRE+H GSF+ +H++DA G+ FATRL N+F I
Sbjct:    1 MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVI 228          
The following BLAST results are available for this feature:
BLAST of CF835375 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 103
Match NameE-valueIdentityDescription
RS4_SOLTU1.620e-12492.5440S ribosomal protein S4 OS=Solanum tuberosum GN=R... [more]
RS42_ARATH1.620e-12492.1140S ribosomal protein S4-2 OS=Arabidopsis thaliana... [more]
RS41_ARATH1.620e-12492.1140S ribosomal protein S4-1 OS=Arabidopsis thaliana... [more]
RS4_MAIZE8.039e-12491.2340S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 ... [more]
RS43_ARATH8.039e-12491.6740S ribosomal protein S4-3 OS=Arabidopsis thaliana... [more]
RS4_GOSHI8.889e-12392.1140S ribosomal protein S4 OS=Gossypium hirsutum GN=... [more]
RS4_ORYSJ1.161e-12290.7940S ribosomal protein S4 OS=Oryza sativa subsp. ja... [more]
RS4_PRUAR6.592e-11889.9140S ribosomal protein S4 OS=Prunus armeniaca GN=RP... [more]
RS4_CRIGR1.931e-9370.6140S ribosomal protein S4 OS=Cricetulus griseus GN=... [more]
RS4_BOVIN2.522e-9370.6140S ribosomal protein S4 OS=Bos taurus GN=RPS4 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C05_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835375 ID=CF835375|Name=CF835375|organism=Citrus sinensis|type=EST|length=737bp
ACGATAGAACAGACAAGCAGCCGCAGCGAGGCAGCAGCTTCACCCTCACA
AAAATGGCTAGAGGATTGAAGAAGCACTTGAAGAGGCTCAATGCCCCTAA
GCACTGGATGCTTGACAAGCTTGGTGGTGCATTTGCACCTAAGCCATCAT
CTGGTCCCCACAAGTCAAGGGAATGCTTGCCATTGATCCTTGTATTGCGA
AACCGTTTGAAATATGCTCTCACATATCGTGAAGTTATTGCTATTCTGAT
GCAACGACATGTTCTTGTTGATGGGAAGGTTAGGACAGATAAGACCTACC
CTGCTGGTTTCATGGATGTTGTGTCAATTCCCAAGACCAACGAGAACTTC
CGTCTCCTTTATGACACCAAGGGTCGCTTCCGTCTCCATTCCCTCAGAGA
TGAGGAGGCAAAATTCAAGCTTTGCAAAGTTAGATCAGTCCAGTTTGGCC
AGAAAGGTATCCCATACATCAACACCTATGATGGGCGTACCATCCGCTAC
CCTGACCCACTCATCAAAGCCAATGATACCATCAAACTTGACTTAGAAGA
GAACAAGATCACTGACTTCATCAAGTTTGATGTTGGGAATATTGTCATGG
TCACTGGGGGTAGAAACAGAGGTCGAGTTGGAATCATCAAGAACAGGGAA
AAGCATAAGGGAAGTTTTGAGACCATCCATATTCAAGATGCCCTTGGTCA
TGAGTTTGCAACTCGTCTAGGCAATGTGTTCACCATC
back to top