CF835376

Overview
NameCF835376
Unique NameCF835376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1103 contig Csv1_Contig1103:941..1817. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERDL4_ARATH (Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 2.176e-76
Identity = 140/201 (69.65%), Postives = 165/201 (82.09%), Query Frame = -3
Query:  273 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQFSFR 875
            GIGLL LQQL GINGVLFYSS IF +AG++SSNVATFG+GVVQVVATG+ TWL+DKAGRR        GM  S  +V++AF+L+ FVS DS  Y+IL ++S+VG+V +VIS SLG+G IPW+IMSEILPVNIK LAGS+ATL NW VSW+VTMTAN LL WSSGGTF +Y +VC FTV FVSLWVPETKG++LEEIQ  FR
Sbjct:  288 GIGLLALQQLGGINGVLFYSSTIFESAGVTSSNVATFGVGVVQVVATGIATWLVDKAGRRLLLMISSIGMTISLVIVAVAFYLKEFVSPDSNMYNILSMVSVVGVVAMVISCSLGMGPIPWLIMSEILPVNIKGLAGSIATLLNWFVSWLVTMTANMLLAWSSGGTFTLYALVCGFTVVFVSLWVPETKGKTLEEIQALFR 488          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERDL6_ARATH (Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.410e-75
Identity = 137/201 (68.16%), Postives = 164/201 (81.59%), Query Frame = -3
Query:  273 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQFSFR 875
            GIGLLVLQQL GINGVLFYSS IF +AG++SSN ATFG+G +QVVAT ++TWL+DKAGRR        GM  S  +V+ AF+L+ FVS DS  YS L ILS+VG+V +V+ FSLG+G IPW+IMSEILPVNIK LAGS+ATLANW  SW++TMTAN LL WSSGGTF +YG+VCAFTV FV+LWVPETKG++LEE+Q  FR
Sbjct:  287 GIGLLVLQQLGGINGVLFYSSTIFESAGVTSSNAATFGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISLVIVAAAFYLKEFVSPDSDMYSWLSILSVVGVVAMVVFFSLGMGPIPWLIMSEILPVNIKGLAGSIATLANWFFSWLITMTANLLLAWSSGGTFTLYGLVCAFTVVFVTLWVPETKGKTLEELQSLFR 487          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERDL5_ARATH (Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 5.227e-46
Identity = 94/201 (46.77%), Postives = 134/201 (66.67%), Query Frame = -3
Query:  279 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGF--VSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQFS 875
            G+GL+VLQQ  G+NG+ FY+S+IF +AG+SS  +    + VVQ+  T +   LMDK+GRR       +G     FLV ++F L+    +S D+ + ++ G+L   G      SFSLG+G IPWVIMSEI P++IK  AGS+ T+ +W+ SWI++ T NFL++W+  GTF ++  VC  TV FV+  VPETKGR+LEEIQ+S
Sbjct:  271 GVGLMVLQQFGGVNGIAFYASSIFESAGVSSK-IGMIAMVVVQIPMTTLGVLLMDKSGRRPLLLISATGTCIGCFLVGLSFSLQFVKQLSGDASYLALTGVLVYTG------SFSLGMGGIPWVIMSEIFPIDIKGSAGSLVTVVSWVGSWIISFTFNFLMNWNPAGTFYVFATVCGATVIFVAKLVPETKGRTLEEIQYS 464          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: EDL16_ARATH (Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 1.332e-41
Identity = 87/201 (43.28%), Postives = 121/201 (60.20%), Query Frame = -3
Query:  273 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQFSFR 875
            G+ L+V QQ  GING+ FY+S  F  AG +S  + T  +  VQV  T + T L+DK+GRR        G+     L   +F L+G     S     +  L++ G++  V +FS+G+G +PWVIMSEI P+N+K +AGS+  L NW  +W V+ T NFL+ WSS GTF +Y    A T+ FV+  VPETKG++LEEIQ   R
Sbjct:  283 GVSLMVFQQFVGINGIGFYASETFVKAGFTSGKLGTIAIACVQVPITVLGTILIDKSGRRPLIMISAGGIFLGCILTGTSFLLKG----QSLLLEWVPSLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPGTFYLYSAFAAATIIFVAKMVPETKGKTLEEIQACIR 479          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERDL7_ARATH (Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 2.273e-41
Identity = 84/195 (43.08%), Postives = 126/195 (64.62%), Query Frame = -3
Query:  285 GLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQ 869
            GL+V QQ  GING+ FY+S+IF  AG  +  +      V+QVV T +N  ++D+AGR+       +G+     + +++F+L+         +  + +L++VG++  + SFS G+GA+PWV+MSEI P+NIK +AG +ATL NW  +W V+ T NFL+ WSS GTFLIY  + A  + FV   VPETKG++LE+IQ
Sbjct:  269 GLMVFQQFGGINGICFYTSSIFEQAGFPT-RLGMIIYAVLQVVITALNAPIVDRAGRKPLLLVSATGLVIGCLIAAVSFYLK----VHDMAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFLIYAAINALAIVFVIAIVPETKGKTLEQIQ 458          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERDL8_ARATH (Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.877e-41
Identity = 88/198 (44.44%), Postives = 123/198 (62.12%), Query Frame = -3
Query:  285 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVN-TWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQ 875
            G+GL+  QQ  GINGV+FY+  IF +AG +S  + +    + QVV T +  T L+D+ GRR        GM     L+  +F L+           I+  L++ G++  + SFS+G+GAIPWVIMSEI P+N+K  AG + T+ NWL SW+V+ T NFL+ WS  GTF +YG VC   + F++  VPETKGR+LEEIQ
Sbjct:  274 GVGLMFFQQFVGINGVIFYAQQIFVSAG-ASPTLGSILYSIEQVVLTALGATLLIDRLGRRPLLMASAVGMLIGCLLIGNSFLLKAH----GLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNWLSSWLVSFTFNFLMIWSPHGTFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQ 466          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERD6_ARATH (Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3)

HSP 1 Score: 160.614 bits (405), Expect = 1.056e-38
Identity = 79/197 (40.10%), Postives = 125/197 (63.45%), Query Frame = -3
Query:  285 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQ 875
            G+GL+ LQQL G +GV +Y+S++F   G  S+ + T  +  + V    + T L+DK GRR       S M  S  L+S+++  + F         +  I + +G++  ++SF++G+G +PW+IM+EI P+N+K  AG++ T+ NWL  WI+T T NF+L+W++ G FLI+ +V A ++ F+   VPETKGRSLEEIQ
Sbjct:  297 GVGLMFLQQLCGSSGVTYYASSLFNKGGFPSA-IGTSVIATIMVPKAMLATVLVDKMGRRTLLMASCSAMGLSALLLSVSYGFQSF----GILPELTPIFTCIGVLGHIVSFAMGMGGLPWIIMAEIFPMNVKVSAGTLVTVTNWLFGWIITYTFNFMLEWNASGMFLIFSMVSASSIVFIYFLVPETKGRSLEEIQ 488          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERDL3_ARATH (Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.167e-37
Identity = 78/199 (39.20%), Postives = 121/199 (60.80%), Query Frame = -3
Query:  279 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQFS 875
            G+GL++LQQLSG +G+++Y  ++F   G  SS + +  L V+ +    +   L++K GRR        GM     L+S +F    +   D     +  I + +G+V  + SF++G+G +PW+IMSEI P+N+K  AG++ TLANW   WIV    NF+L+W++ GTFLI+  +C   + F+   VPETKGR+LE+IQ S
Sbjct:  271 GVGLMLLQQLSGSSGLMYYVGSVFDKGGFPSS-IGSMILAVIMIPKALLGLILVEKMGRRPLLLASTGGMCFFSLLLSFSFCFRSYGMLDE----LTPIFTCIGVVGFISSFAVGMGGLPWIIMSEIFPMNVKVSAGTLVTLANWSFGWIVAFAYNFMLEWNASGTFLIFFTICGAGIVFIYAMVPETKGRTLEDIQAS 464          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERDL2_ARATH (Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 4.435e-37
Identity = 78/199 (39.20%), Postives = 121/199 (60.80%), Query Frame = -3
Query:  279 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQFS 875
            G+GL++LQQ  G   +  Y++ IF  AG  S ++ T  L V+ +  + V    +D+ GRR        GM    F + ++++L+    ++  F  +  ++ +VGLV  V SF +G+G +PWVIMSEI PVN+K  AGS+ T++NW  +WI+  + NF++ WS+ GT+ I+  V   T+ F+   VPETKGR+LEEIQ S
Sbjct:  264 GLGLMLLQQFCGSAAISAYAARIFDKAGFPS-DIGTTILAVILIPQSIVVMLTVDRWGRRPLLMISSIGMCICSFFIGLSYYLQ----KNGEFQKLCSVMLIVGLVGYVSSFGIGLGGLPWVIMSEIFPVNVKITAGSLVTMSNWFFNWIIIYSFNFMIQWSASGTYFIFSGVSLVTIVFIWTLVPETKGRTLEEIQTS 457          
BLAST of CF835376 vs. ExPASy Swiss-Prot
Match: ERDL1_ARATH (Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 6.405e-36
Identity = 77/199 (38.69%), Postives = 120/199 (60.30%), Query Frame = -3
Query:  279 GIGLLVLQQLSGINGVLFYSSNIFANAGISSSNVATFGLGVVQVVATGVNTWLMDKAGRRXXXXXXXSGMAASFFLVSIAFFLEGFVSEDSRFYSILGILSLVGLVTVVISFSLGVGAIPWVIMSEILPVNIKSLAGSVATLANWLVSWIVTMTANFLLDWSSGGTFLIYGIVCAFTVAFVSLWVPETKGRSLEEIQFS 875
            G+GL++LQQ  G + +  Y++ IF  AG  S ++ T  L V+ V  + +  + +D+ GRR        G+    FL+ ++++L+        F      + +VGLV  V+SF +G+G +PWVIMSE+ PVN+K  AGS+ T++NW  SWI+  + NF++ WS+ GT+ I+  V   +  FV   VPETKGR+LE+IQ S
Sbjct:  266 GLGLMLLQQFCGSSAISAYAARIFDTAGFPS-DIGTSILAVILVPQSIIVMFAVDRCGRRPLLMSSSIGLCICSFLIGLSYYLQNH----GDFQEFCSPILIVGLVGYVLSFGIGLGGLPWVIMSEVFPVNVKITAGSLVTVSNWFFSWIIIFSFNFMMQWSAFGTYFIFAGVSLMSFVFVWTLVPETKGRTLEDIQQS 459          
The following BLAST results are available for this feature:
BLAST of CF835376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 163
Match NameE-valueIdentityDescription
ERDL4_ARATH2.176e-7669.65Sugar transporter ERD6-like 4 OS=Arabidopsis thali... [more]
ERDL6_ARATH1.410e-7568.16Sugar transporter ERD6-like 6 OS=Arabidopsis thali... [more]
ERDL5_ARATH5.227e-4646.77Sugar transporter ERD6-like 5 OS=Arabidopsis thali... [more]
EDL16_ARATH1.332e-4143.28Sugar transporter ERD6-like 16 OS=Arabidopsis thal... [more]
ERDL7_ARATH2.273e-4143.08Sugar transporter ERD6-like 7 OS=Arabidopsis thali... [more]
ERDL8_ARATH3.877e-4144.44Sugar transporter ERD6-like 8 OS=Arabidopsis thali... [more]
ERD6_ARATH1.056e-3840.10Sugar transporter ERD6 OS=Arabidopsis thaliana GN=... [more]
ERDL3_ARATH1.167e-3739.20Sugar transporter ERD6-like 3 OS=Arabidopsis thali... [more]
ERDL2_ARATH4.435e-3739.20Sugar transporter ERD6-like 2 OS=Arabidopsis thali... [more]
ERDL1_ARATH6.405e-3638.69Sugar transporter ERD6-like 1 OS=Arabidopsis thali... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C07_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835376 ID=CF835376|Name=CF835376|organism=Citrus sinensis|type=EST|length=877bp
TTTTTTTTTTTTTTTCCCAAAACTGGAGATAATTATTTACTACCCCTTAA
TGTTCCAGTGAAAAAGAGTAATTTATCCATTGCCCTTTCCTTTTCCCCTT
CAACAACACCACAAAGCAACTGTCGTAGACCGCCCCTACAGATGATACAA
TGAACTATGGAGCAATGATGGAAGCAATTCGCACAAATAAAAGCGCATTG
ACATATACTTGGGAAGGATTAGGACACATGGGTGGAGAAGCTCTTTATTA
CAAATGCAAGCCAACAATTTTATCTGAAGGAAAACTGAATTTCTTCCAGA
CTTCTTCCTTTGGTTTCAGGAACCCAGAGAGACACAAAAGCAACAGTGAA
AGCACACACTATCCCGTATATCAAGAAGGTGCCTCCACTGCTCCAATCTA
ACAGAAAATTTGCAGTCATTGTGACAATCCACGATACCAGCCAGTTTGCC
AACGTTGCAACACTGCCAGCAAGGCTCTTGATATTCACTGGAAGTATCTC
GGACATTATAACCCAAGGAATAGCTCCAACTCCCAAAGAGAATGAAATCA
CTACAGTCACAAGACCGACAAGCGACAATATCCCCAATATGCTATAAAAG
CGAGAATCTTCTGACACAAAACCCTCCAAAAAGAATGCAATCGAAACAAG
GAAAAAACTAGCAGCCATTCCAGATGATGATATTAAAAGAAGAAGCCTGC
GGCCAGCTTTGTCCATCAACCATGTATTGACCCCAGTGGCAACAACCTGA
ACAACCCCAAGTCCAAATGTAGCAACGTTACTTGATGAAATCCCAGCGTT
AGCAAAAATGTTACTGGAATAGAATAAAACACCATTGATGCCACTGAGTT
GCTGAAGAACCAGTAATCCTATTCCTA
back to top