CF835382

Overview
NameCF835382
Unique NameCF835382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length676
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9673 contig Csv1_Contig9673:155..830. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_MOUSE (Eukaryotic translation initiation factor 6 OS=Mus musculus GN=Eif6 PE=1 SV=2)

HSP 1 Score: 343.584 bits (880), Expect = 5.699e-94
Identity = 168/223 (75.34%), Postives = 193/223 (86.55%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAI 670
            +CEV  F+KLTNA+CLVAIGGSE+FYS F+ EL+D IPVV  SI G RIIGR+CVGN++GLL+P+ TTDQELQH+RNSLPD V ++R+EERLSALGN   CND+VAL H  LDRETEEI+ADVL VEVFRQTVA  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VNDW AFCG DTT+TELSV+ESVFKL EA+P+ I
Sbjct:   10 NCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAKPSTI 232          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_HUMAN (Eukaryotic translation initiation factor 6 OS=Homo sapiens GN=EIF6 PE=1 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 9.721e-94
Identity = 167/223 (74.89%), Postives = 192/223 (86.10%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAI 670
            +CE+  F+KLTN +CLVAIGGSE+FYS F+ EL+D IPVV  SI G RIIGR+CVGN++GLL+P+ TTDQELQH+RNSLPD V ++R+EERLSALGN   CND+VAL H  LDRETEEI+ADVL VEVFRQTVA  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VNDW AFCG DTT+TELSV+ESVFKL EAQP+ I
Sbjct:   10 NCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTI 232          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_BOVIN (Eukaryotic translation initiation factor 6 OS=Bos taurus GN=EIF6 PE=2 SV=2)

HSP 1 Score: 340.117 bits (871), Expect = 6.301e-93
Identity = 166/223 (74.44%), Postives = 191/223 (85.65%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAI 670
            +CE+  F+KLTN++CLVAIGGSE+FYS F+ ELA  IPVV  SI G RIIGR+CVGN++GLL+P+ TTDQELQH+RN LPD V ++R+EERLSALGN   CND+VAL H  LDRETEEI+ADVL VEVFRQTVA  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VNDW AFCG DTT+TELSV+ESVFKL EAQP+ I
Sbjct:   10 NCEIGCFAKLTNSYCLVAIGGSENFYSVFEGELAGTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNCLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTI 232          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_SCHPO (Eukaryotic translation initiation factor 6 OS=Schizosaccharomyces pombe GN=tif6 PE=2 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.006e-90
Identity = 161/224 (71.88%), Postives = 193/224 (86.16%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIV 673
            S E+  FS LTN++ LVA+GGSE+FYS F+AEL DV+PVV T+IGG RIIGRL  GN+ GLL+P +TTD ELQHLRNSLPD V +QR++ERLSALGN +ACND+VAL H  ++RETEEIIADVL VEVFRQTVAGN+L GSYC+ SN+G LVHP TSI++ DELS+LLQVPLVAGT+NRGS+VIGAGL VNDW AF G DTTATEL+V ES+FKL++AQP+AI+
Sbjct:   10 SNEIGVFSNLTNSYALVALGGSENFYSVFEAELGDVVPVVHTTIGGTRIIGRLTCGNRKGLLVPSSTTDNELQHLRNSLPDPVKIQRVDERLSALGNIVACNDYVALVHPDIERETEEIIADVLDVEVFRQTVAGNVLTGSYCALSNQGALVHPRTSIQEQDELSSLLQVPLVAGTINRGSDVIGAGLVVNDWCAFAGLDTTATELAVCESIFKLQDAQPSAII 233          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_YEAST (Eukaryotic translation initiation factor 6 OS=Saccharomyces cerevisiae GN=TIF6 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 8.516e-90
Identity = 159/223 (71.30%), Postives = 190/223 (85.20%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAI 670
            S E+  FSKLTN +CLVA+GGSE+FYS F+AEL D IP+V T+I G RIIGR+  GN+ GLL+P  TTDQELQHLRNSLPD V +QR+EERLSALGN I CND+VAL H  +DRETEE+I+DVLGVEVFRQT++GNILVGSYCS SN+GGLVHP TS++D +ELS+LLQVPLVAGTVNRGS V+GAG+ VND+ A  G DTTA ELSVIES+F+L++AQP +I
Sbjct:   10 SNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESI 232          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_DROME (Probable eukaryotic translation initiation factor 6 OS=Drosophila melanogaster GN=eIF6 PE=2 SV=3)

HSP 1 Score: 324.324 bits (830), Expect = 3.578e-88
Identity = 159/221 (71.95%), Postives = 188/221 (85.07%), Query Frame = 2
Query:    8 EVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAI 670
            ++  F+KLTN +CLVAIGGSE+FYS F+AEL D IPVV  ++GG RIIGRL VGN+NGLL+P++TTD+ELQHLRNSLPD V + R+EERLSALGN IACND+VAL H  LD+ETEEIIADVL VEVFRQT+A N LVGSY   SN+GG+VHP TSI+D DELS+LLQVPLVAGTVNRGSEV+ AG+ VNDW +F G +TTATE+SVIESVFKL +AQP  +
Sbjct:   12 DIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVHANVGGCRIIGRLTVGNRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEERLSALGNVIACNDYVALVHPDLDKETEEIIADVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAAGMVVNDWLSFVGMNTTATEISVIESVFKLNQAQPATV 232          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_ARATH (Eukaryotic translation initiation factor 6 OS=Arabidopsis thaliana GN=At2g39820 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 2.835e-85
Identity = 152/224 (67.86%), Postives = 190/224 (84.82%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLV-AIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAI 670
            +CE+  FSKLTNA+CLV A   S +F++ ++++L  VIP+V TSIGG+  IG LCVGNKNGLLL HT TDQELQHLR+SLPD+VVVQRIEE + ALGN IACND+VAL H  L+++TEEII+DVLGVEV+RQT+A N LVGSYCS SN GG+VH +T++E++ EL+ L+QVPLVAGTVNRGS+VI AGLTVNDWTAFCGSDTTA ELSV+ ++FKL ++QP+ +
Sbjct:   11 NCEIGVFSKLTNAYCLVSATSASANFFTGYESKLKGVIPIVTTSIGGSGTIGSLCVGNKNGLLLSHTITDQELQHLRDSLPDEVVVQRIEEPICALGNAIACNDYVALVHPKLEKDTEEIISDVLGVEVYRQTIANNELVGSYCSLSNNGGMVHSNTNVEEMVELANLVQVPLVAGTVNRGSQVISAGLTVNDWTAFCGSDTTAVELSVVNNIFKLVQSQPDFV 234          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_DICDI (Probable eukaryotic translation initiation factor 6 OS=Dictyostelium discoideum GN=eif6 PE=3 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 3.703e-85
Identity = 156/225 (69.33%), Postives = 185/225 (82.22%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVD 676
            SC+V  F KLTN +CLV   GS+ F  T +  LAD IPVV+TSI G RI+GRL  GNKNGLLLP+T TDQELQ +RNSLPD VVVQRIEE+ SALGNCIA ND+VAL H  +DRETEEIIADVLGVEVFRQTV+GN+LVG+YC+ +N+G LVHP TSI D DELS+LLQVPLVAGTVNRG+E + AG  VNDWTA  G+DTTATE+SVIES+F L+ ++P+ I++
Sbjct:   10 SCDVGVFLKLTNKYCLVGQCGSKQFLHTVENRLADHIPVVETSIAGTRIVGRLSAGNKNGLLLPNTCTDQELQQIRNSLPDDVVVQRIEEKFSALGNCIATNDYVALVHPDIDRETEEIIADVLGVEVFRQTVSGNVLVGTYCALTNQGALVHPMTSIADQDELSSLLQVPLVAGTVNRGNECVAAGCVVNDWTAIVGADTTATEISVIESIFALQGSKPSNIIN 234          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_BETVU (Eukaryotic translation initiation factor 6 (Fragment) OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 6.983e-84
Identity = 154/184 (83.70%), Postives = 167/184 (90.76%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI 553
            +CEV  FSKLTNA+CLVAIGGSE+FYSTF+ ELAD IPVVKTSI G RIIG     NKNGLL+PHTTTDQELQHLRN LPD VVVQRIEE+LSALGNCIACND+VAL HT LD+ETEE+IADVLGVEVF QT+AGNILVGSYC+ +N+GGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI
Sbjct:   10 NCEVGVFSKLTNAYCLVAIGGSENFYSTFETELADYIPVVKTSIAGTRIIGPNVCRNKNGLLVPHTTTDQELQHLRNCLPDSVVVQRIEEKLSALGNCIACNDYVALTHTDLDKETEELIADVLGVEVFGQTIAGNILVGSYCAITNKGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI 193          
BLAST of CF835382 vs. ExPASy Swiss-Prot
Match: IF6_CAEEL (Eukaryotic translation initiation factor 6 OS=Caenorhabditis elegans GN=eif-6 PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.724e-74
Identity = 134/217 (61.75%), Postives = 172/217 (79.26%), Query Frame = 2
Query:    2 SCEVAFFSKLTNAFCLVAIGGSESFYSTFQAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTYLDRETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLRE 652
            S +V  F  LTN++CLV +GG+++FYS  +AEL+D+IPVV TSI   RI+GRL VGN++GLL+P+ TTDQELQHLRNSLPD+V ++R++ERLSALGN IACNDHVA+ H  +  ETE+ + +VL VEVFR ++A N LVGSYC  S+ G LV   T  E   E++ LLQ+P+VAGT NRGSE+IGAG+ VNDW AFCG D+T+TELSV+ES+FKL E
Sbjct:   10 SNDVGVFCTLTNSYCLVGVGGTQNFYSILEAELSDLIPVVHTSIASTRIVGRLTVGNRHGLLVPNATTDQELQHLRNSLPDEVAIRRVDERLSALGNVIACNDHVAIVHAEISAETEQALVEVLKVEVFRVSLAQNSLVGSYCILSSNGCLVAARTPPETQREIAALLQIPVVAGTCNRGSELIGAGMVVNDWVAFCGLDSTSTELSVVESIFKLGE 226          
The following BLAST results are available for this feature:
BLAST of CF835382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
IF6_MOUSE5.699e-9475.34Eukaryotic translation initiation factor 6 OS=Mus ... [more]
IF6_HUMAN9.721e-9474.89Eukaryotic translation initiation factor 6 OS=Homo... [more]
IF6_BOVIN6.301e-9374.44Eukaryotic translation initiation factor 6 OS=Bos ... [more]
IF6_SCHPO1.006e-9071.88Eukaryotic translation initiation factor 6 OS=Schi... [more]
IF6_YEAST8.516e-9071.30Eukaryotic translation initiation factor 6 OS=Sacc... [more]
IF6_DROME3.578e-8871.95Probable eukaryotic translation initiation factor ... [more]
IF6_ARATH2.835e-8567.86Eukaryotic translation initiation factor 6 OS=Arab... [more]
IF6_DICDI3.703e-8569.33Probable eukaryotic translation initiation factor ... [more]
IF6_BETVU6.983e-8483.70Eukaryotic translation initiation factor 6 (Fragme... [more]
IF6_CAEEL1.724e-7461.75Eukaryotic translation initiation factor 6 OS=Caen... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C10_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835382 ID=CF835382|Name=CF835382|organism=Citrus sinensis|type=EST|length=676bp
TTCGTGTGAGGTTGCTTTTTTTTCCAAGCTCACTAATGCTTTTTGCTTGG
TCGCAATTGGAGGTTCTGAGAGCTTCTACAGCACATTTCAAGCGGAGTTA
GCAGATGTTATTCCTGTTGTTAAAACATCAATTGGTGGCAACAGGATTAT
CGGGCGGCTTTGTGTTGGTAACAAAAATGGGCTTCTCTTGCCACACACAA
CCACAGACCAAGAGCTTCAACACTTGAGGAATAGTCTACCTGATCAAGTT
GTTGTCCAGCGTATTGAAGAGAGGCTATCTGCTCTGGGAAATTGCATAGC
ATGCAATGACCATGTTGCTCTTGCACACACATATCTTGACAGGGAAACGG
AGGAAATTATTGCAGATGTTCTTGGAGTAGAAGTTTTTAGGCAGACAGTT
GCCGGTAATATCCTTGTTGGCAGTTACTGTTCCTTCAGCAACAGGGGTGG
CTTGGTCCACCCTCATACATCCATTGAAGACTTGGATGAACTCTCTACAC
TCTTGCAAGTACCTTTGGTTGCTGGCACTGTGAACCGTGGAAGTGAAGTG
ATAGGTGCTGGGTTAACTGTGAATGACTGGACAGCATTCTGTGGGTCAGA
CACCACGGCAACCGAACTCTCTGTTATTGAGAGCGTTTTCAAGTTGAGGG
AAGCTCAACCAAATGCCATTGTGGAT
back to top