CF835383

Overview
NameCF835383
Unique NameCF835383
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length669
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF835383_ssr72 microsatellite CF835383_ssr72:72..83. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1104 contig Csv1_Contig1104:1..669. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_HUMAN (Eukaryotic translation initiation factor 6 OS=Homo sapiens GN=EIF6 PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 6.009e-48
Identity = 96/120 (80.00%), Postives = 104/120 (86.67%), Query Frame = -3
Query:  308 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVDEMRKSLIDS 667
            ETEEI+ADVL VEVFRQTVA  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VNDW AFCG DTT+TELSV+ESVFKL EAQP+ I   MR SLIDS
Sbjct:  124 ETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDS 243          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_BOVIN (Eukaryotic translation initiation factor 6 OS=Bos taurus GN=EIF6 PE=2 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 6.009e-48
Identity = 96/120 (80.00%), Postives = 104/120 (86.67%), Query Frame = -3
Query:  308 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVDEMRKSLIDS 667
            ETEEI+ADVL VEVFRQTVA  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VNDW AFCG DTT+TELSV+ESVFKL EAQP+ I   MR SLIDS
Sbjct:  124 ETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDS 243          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_MOUSE (Eukaryotic translation initiation factor 6 OS=Mus musculus GN=Eif6 PE=1 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 1.748e-47
Identity = 95/120 (79.17%), Postives = 104/120 (86.67%), Query Frame = -3
Query:  308 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVDEMRKSLIDS 667
            ETEEI+ADVL VEVFRQTVA  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VNDW AFCG DTT+TELSV+ESVFKL EA+P+ I   MR SLIDS
Sbjct:  124 ETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAKPSTIATSMRDSLIDS 243          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_ARATH (Eukaryotic translation initiation factor 6 OS=Arabidopsis thaliana GN=At2g39820 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 7.345e-46
Identity = 87/122 (71.31%), Postives = 108/122 (88.52%), Query Frame = -3
Query:  302 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVDEMRKSLIDSYV 667
            +TEEII+DVLGVEV+RQT+A N LVGSYCS SN GG+VH +T++E++ EL+ L+QVPLVAGTVNRGS+VI AGLTVNDWTAFCGSDTTA ELSV+ ++FKL ++QP+ +  EMRKSLID+YV
Sbjct:  126 DTEEIISDVLGVEVYRQTIANNELVGSYCSLSNNGGMVHSNTNVEEMVELANLVQVPLVAGTVNRGSQVISAGLTVNDWTAFCGSDTTAVELSVVNNIFKLVQSQPDFVGSEMRKSLIDTYV 247          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_SCHPO (Eukaryotic translation initiation factor 6 OS=Schizosaccharomyces pombe GN=tif6 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.761e-45
Identity = 89/121 (73.55%), Postives = 106/121 (87.60%), Query Frame = -3
Query:  305 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVDEMRKSLIDSY 667
            ETEEIIADVL VEVFRQTVAGN+L GSYC+ SN+G LVHP TSI++ DELS+LLQVPLVAGT+NRGS+VIGAGL VNDW AF G DTTATEL+V ES+FKL++AQP+AI+   R +L++SY
Sbjct:  124 ETEEIIADVLDVEVFRQTVAGNVLTGSYCALSNQGALVHPRTSIQEQDELSSLLQVPLVAGTINRGSDVIGAGLVVNDWCAFAGLDTTATELAVCESIFKLQDAQPSAIISN-RDTLVESY 243          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_YEAST (Eukaryotic translation initiation factor 6 OS=Saccharomyces cerevisiae GN=TIF6 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.264e-44
Identity = 85/121 (70.25%), Postives = 106/121 (87.60%), Query Frame = -3
Query:  305 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVDEMRKSLIDSY 667
            ETEE+I+DVLGVEVFRQT++GNILVGSYCS SN+GGLVHP TS++D +ELS+LLQVPLVAGTVNRGS V+GAG+ VND+ A  G DTTA ELSVIES+F+L++AQP +I   +R +LI++Y
Sbjct:  124 ETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTLIETY 244          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_DICDI (Probable eukaryotic translation initiation factor 6 OS=Dictyostelium discoideum GN=eif6 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.928e-43
Identity = 82/120 (68.33%), Postives = 104/120 (86.67%), Query Frame = -3
Query:  308 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVDEMRKSLIDS 667
            ETEEIIADVLGVEVFRQTV+GN+LVG+YC+ +N+G LVHP TSI D DELS+LLQVPLVAGTVNRG+E + AG  VNDWTA  G+DTTATE+SVIES+F L+ ++P+ I++ +R S++D+
Sbjct:  124 ETEEIIADVLGVEVFRQTVSGNVLVGTYCALTNQGALVHPMTSIADQDELSSLLQVPLVAGTVNRGNECVAAGCVVNDWTAIVGADTTATEISVIESIFALQGSKPSNIINNIRNSIVDN 243          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_DROME (Probable eukaryotic translation initiation factor 6 OS=Drosophila melanogaster GN=eIF6 PE=2 SV=3)

HSP 1 Score: 169.474 bits (428), Expect = 1.434e-41
Identity = 84/119 (70.59%), Postives = 100/119 (84.03%), Query Frame = -3
Query:  311 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPNAIVDEMRKSLID 667
            ETEEIIADVL VEVFRQT+A N LVGSY   SN+GG+VHP TSI+D DELS+LLQVPLVAGTVNRGSEV+ AG+ VNDW +F G +TTATE+SVIESVFKL +AQP  +  ++R +LI+
Sbjct:  124 ETEEIIADVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAAGMVVNDWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIE 242          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_CAEEL (Eukaryotic translation initiation factor 6 OS=Caenorhabditis elegans GN=eif-6 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.294e-31
Identity = 69/121 (57.02%), Postives = 91/121 (75.21%), Query Frame = -3
Query:  308 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVNDWTAFCGSDTTATELSVIESVFKLRE-AQPNAIVDEMRKSLIDS 667
            ETE+ + +VL VEVFR ++A N LVGSYC  S+ G LV   T  E   E++ LLQ+P+VAGT NRGSE+IGAG+ VNDW AFCG D+T+TELSV+ES+FKL E   P +I +++R +LI+S
Sbjct:  124 ETEQALVEVLKVEVFRVSLAQNSLVGSYCILSSNGCLVAARTPPETQREIAALLQIPVVAGTCNRGSELIGAGMVVNDWVAFCGLDSTSTELSVVESIFKLGEQGAPTSISNQLRDTLIES 244          
BLAST of CF835383 vs. ExPASy Swiss-Prot
Match: IF6_BETVU (Eukaryotic translation initiation factor 6 (Fragment) OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.644e-29
Identity = 63/70 (90.00%), Postives = 68/70 (97.14%), Query Frame = -3
Query:  458 ETEEIIADVLGVEVFRQTVAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI 667
            ETEE+IADVLGVEVF QT+AGNILVGSYC+ +N+GGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI
Sbjct:  124 ETEELIADVLGVEVFGQTIAGNILVGSYCAITNKGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI 193          
The following BLAST results are available for this feature:
BLAST of CF835383 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
IF6_HUMAN6.009e-4880.00Eukaryotic translation initiation factor 6 OS=Homo... [more]
IF6_BOVIN6.009e-4880.00Eukaryotic translation initiation factor 6 OS=Bos ... [more]
IF6_MOUSE1.748e-4779.17Eukaryotic translation initiation factor 6 OS=Mus ... [more]
IF6_ARATH7.345e-4671.31Eukaryotic translation initiation factor 6 OS=Arab... [more]
IF6_SCHPO4.761e-4573.55Eukaryotic translation initiation factor 6 OS=Schi... [more]
IF6_YEAST5.264e-4470.25Eukaryotic translation initiation factor 6 OS=Sacc... [more]
IF6_DICDI9.928e-4368.33Probable eukaryotic translation initiation factor ... [more]
IF6_DROME1.434e-4170.59Probable eukaryotic translation initiation factor ... [more]
IF6_CAEEL2.294e-3157.02Eukaryotic translation initiation factor 6 OS=Caen... [more]
IF6_BETVU1.644e-2990.00Eukaryotic translation initiation factor 6 (Fragme... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C10_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835383 ID=CF835383|Name=CF835383|organism=Citrus sinensis|type=EST|length=669bp
CTCGAGNTTTTTCTTTTTAGGGTTTTGGGCGATTTATGAATATCATTATA
TCCCCTGTCGTCTTTCAAAATATACATACATACAGACATAATTGTCACCT
TCAGAAAGCGGGCAGCCAAGTTAAGCAGGCAACAGTGAAATACAGAGTTT
GTGAGCAAGGATTTCATGTAATCGAGTATTGCTCAAGCTACTACGTACTC
CAACATGAGAAAGAAAACATTCTAATAGCTCTCAAGAAAGTTAGGAAATA
GTGTTTCACACAATAAGACAAAACACAAGACTGCTTATCCCAGATAACTT
AGACATAGCTGTCAATTAAAGATTTCCTCATCTCATCCACAATGGCATTT
GGTTGAGCTTCCCTCAACTTGAAAACGCTCTCAATAACAGAGAGTTCGGT
TGCCGTGGTGTCTGACCCACAGAATGCTGTCCAGTCATTCACAGTTAACC
CAGCACCTATCACTTCACTTCCACGGTTCACAGTGCCAGCAACCAAAGGT
ACTTGCAAGAGTGTAGAGAGTTCATCCAAGTCTTCAATGGATGTATGAGG
GTGGACCAAGCCACCCCTGTTGCTGAAGGAACAGTAACTGCCAACAAGGA
TATTACCGGCAACTGTCTGCCTAAAAACTTCTACTCCAAGAACATCTGCA
ATAATTTCCTCCGTTTCCC
back to top