CF835385

Overview
NameCF835385
Unique NameCF835385
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length737
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9884 contig Csv1_Contig9884:19..755. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 7.542e-114
Identity = 195/218 (89.45%), Postives = 205/218 (94.04%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F GKAV L+PS +E++  GR++MRKT +K+   SSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVKEIKNG LAMFSMFGFF
Sbjct:   13 FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 9.850e-114
Identity = 194/218 (88.99%), Postives = 206/218 (94.50%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNG LAMFSMFGFF
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 1.287e-113
Identity = 194/218 (88.99%), Postives = 206/218 (94.50%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNG LAMFSMFGFF
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 229          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 4.889e-113
Identity = 193/216 (89.35%), Postives = 202/216 (93.52%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F G+AV L+PS +E+S  GRI+MRK  +KS  S SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNG LAMFSMFGFF
Sbjct:   13 FAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 228          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 4.889e-113
Identity = 191/216 (88.43%), Postives = 203/216 (93.98%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F G+AV L+PS  E++  GR+SMRKT +K V+S SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNG LAMFSMFGFF
Sbjct:   13 FAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 228          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 1.089e-112
Identity = 191/214 (89.25%), Postives = 202/214 (94.39%), Query Frame = 2
Query:   95 GKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            G+AV L+P+  E+    + +MRKT SKSVSSGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLADDPEAFAELKVKE+KNG LAMFSMFGFF
Sbjct:    5 GQAVKLSPNAPEIQGNAKFTMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF 218          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB27_TOBAC (Chlorophyll a-b binding protein 7, chloroplastic OS=Nicotiana tabacum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 1.422e-112
Identity = 193/218 (88.53%), Postives = 204/218 (93.58%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F G AV L+PS +E++  G+  MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNG LAMFSMFGFF
Sbjct:   13 FAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 2.426e-112
Identity = 192/218 (88.07%), Postives = 205/218 (94.04%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F GKAV L+PS +E++  G+++MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNG LAMFSMFGFF
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 229          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 4.139e-112
Identity = 191/218 (87.61%), Postives = 205/218 (94.04%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F GKAV L+PS +E++  G+++MRKT +K+  +SSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVK IKNG LAMFSMFGFF
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKHIKNGRLAMFSMFGFF 230          
BLAST of CF835385 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 1.204e-111
Identity = 192/218 (88.07%), Postives = 203/218 (93.12%), Query Frame = 2
Query:   89 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGTLAMFSMFGFF 736
            F GKAV  +PS +E++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTA LSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVKEIKNG LAMFSMFGFF
Sbjct:   13 FAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
The following BLAST results are available for this feature:
BLAST of CF835385 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
CB2G_SOLLC7.542e-11489.45Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC9.850e-11488.99Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC1.287e-11388.99Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB2B_SOLLC4.889e-11389.35Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB22_TOBAC4.889e-11388.43Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB21_CUCSA1.089e-11289.25Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB27_TOBAC1.422e-11288.53Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB25_NICPL2.426e-11288.07Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB25_TOBAC4.139e-11287.61Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB25_PETSP1.204e-11188.07Chlorophyll a-b binding protein 91R, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C11_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835385 ID=CF835385|Name=CF835385|organism=Citrus sinensis|type=EST|length=737bp
TGCTTACACAGCTCCTATTGCTTACCCAGCTTCTGCTTCTCAATTAAATT
CCTCAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAG
GCCGTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCAT
CTCCATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGTAGCCCGTGGT
ACGGCCCGGACAGAGTCAAGTACTTGGGCCCACTCTCTGGCGAGCCCCCA
AGCTACTTGACTGGTGAGTTCCCTGGCGACTACGGTTGGGACACTGCCGG
GCTTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCA
TCCACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAG
CTCTTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCTGTGTGGTTCAAGGC
GGGAGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAA
GCTTGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTC
TTGATGGGAGCCGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGA
AGTGACTGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGG
CTGATGACCCGGAGGCTTTTGCTGAGCTCAAGGTTAAGGAAATCAAGAAT
GGAACGTTGGCTATGTTCTCCATGTTTGGTTTCTTCG
back to top