CF835573

Overview
NameCF835573
Unique NameCF835573
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length784
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF835573_ssr419 microsatellite CF835573_ssr419:419..430. BLAST: Citrus ESTs to Prunus persica proteins V1
CF835573_ssr26 microsatellite CF835573_ssr26:26..37. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9758 contig Csv1_Contig9758:16..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835573 vs. ExPASy Swiss-Prot
Match: U131_ARATH (UPF0131 protein At3g02910 OS=Arabidopsis thaliana GN=At3g02910 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.558e-48
Identity = 101/176 (57.39%), Postives = 120/176 (68.18%), Query Frame = 3
Query:  129 LIFTYGTLKRGFSNHNLIQDLMLTGDAVFRGAYTTSESFPLVCGPYRVPFLLNIPGSGHPVTGELYAVSAYGLSRMDELEGTSRGHYQRLGPIRV--TKXXXXXXXXXXXXXXXXXXXXXXXXXRSYEMELWKKSGKLGFRWYGEKEAKGYVKRKDRPQNLSFLEHIRIFLSSSTD 650
            L+FTYGTLKRGFSNH L+QDL+ +GDA F+G Y T + +PLVCGPYRVPFLLN PGSG+ V GELYAVS  GLSR+DELEG SRGHY R  PIR+   +                         +SYE ELW+++    F  Y E EA+GYVKR DRPQ+LSFL+HIRIF+SS  D
Sbjct:    8 LVFTYGTLKRGFSNHVLMQDLIRSGDASFKGVYQTLDKYPLVCGPYRVPFLLNKPGSGYHVNGELYAVSPRGLSRLDELEGISRGHYIR-QPIRLAAAEEEEEEEGDLETEAPSSCVVEAYYAHKSYEEELWRRNRGRSFGAYTENEARGYVKRNDRPQHLSFLDHIRIFVSSPCD 182          
BLAST of CF835573 vs. ExPASy Swiss-Prot
Match: A2LD1_RAT (AIG2-like domain-containing protein 1 OS=Rattus norvegicus GN=A2ld1 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.846e-13
Identity = 45/91 (49.45%), Postives = 55/91 (60.44%), Query Frame = 3
Query:  126 ALIFTYGTLKRGFSNHNLIQDLMLTGDAVFRGAYTTSESFPLV-CGPYRVPFLLNIPGSGHPVTGELYAVSAYGLSRMDELEGTSRGHYQR 395
            A IF YGTLKRG  NH ++ D    G A FRG   T ESFPLV  G + +P+LL++PG GH V GE+Y V    L  +D+ EG     YQR
Sbjct:    2 AHIFVYGTLKRGQPNHKVMLD-QSHGLATFRGRGCTVESFPLVIAGEHNIPWLLHLPGKGHCVAGEIYEVDEQMLRFLDDFEGCP-SMYQR 90          
BLAST of CF835573 vs. ExPASy Swiss-Prot
Match: A2LD1_MOUSE (AIG2-like domain-containing protein 1 OS=Mus musculus GN=a2ld1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.844e-12
Identity = 42/82 (51.22%), Postives = 51/82 (62.20%), Query Frame = 3
Query:  126 ALIFTYGTLKRGFSNHNLIQDLMLTGDAVFRGAYTTSESFPLV-CGPYRVPFLLNIPGSGHPVTGELYAVSAYGLSRMDELE 368
            A IF YGTLKRG  NH ++ D    G A FRG   T ESFPLV  G + +P+LL +PG GH VTGE+Y V    L  +D+ E
Sbjct:    2 AHIFVYGTLKRGQPNHKVMLDHS-HGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGEIYEVDEQMLRFLDDFE 82          
BLAST of CF835573 vs. ExPASy Swiss-Prot
Match: A2LD1_HUMAN (AIG2-like domain-containing protein 1 OS=Homo sapiens GN=A2LD1 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 5.366e-12
Identity = 39/82 (47.56%), Postives = 52/82 (63.41%), Query Frame = 3
Query:  126 ALIFTYGTLKRGFSNHNLIQDLMLTGDAVFRGAYTTSESFPLV-CGPYRVPFLLNIPGSGHPVTGELYAVSAYGLSRMDELE 368
            AL+F YGTLKRG  NH +++D    G A FR    T E +PLV  G + +P+LL++PGSG  V GE+YAV    L  +D+ E
Sbjct:    2 ALVFVYGTLKRGQPNHRVLRD-GAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFE 82          
BLAST of CF835573 vs. ExPASy Swiss-Prot
Match: A2LD1_BOVIN (AIG2-like domain-containing protein 1 OS=Bos taurus GN=A2LD1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11
Identity = 39/82 (47.56%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  126 ALIFTYGTLKRGFSNHNLIQDLMLTGDAVFRGAYTTSESFPLV-CGPYRVPFLLNIPGSGHPVTGELYAVSAYGLSRMDELE 368
            A +F YGTLK G  NH ++ D    G A FRG   T E +PLV  G + +P LLN+PG GH V GE+Y V    L  +DE E
Sbjct:   27 APVFVYGTLKTGQPNHRVLLD-GAHGRAAFRGRAHTLEPYPLVIAGEHNIPRLLNLPGRGHRVFGEVYEVDERMLRFLDEFE 107          
The following BLAST results are available for this feature:
BLAST of CF835573 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
U131_ARATH3.558e-4857.39UPF0131 protein At3g02910 OS=Arabidopsis thaliana ... [more]
A2LD1_RAT2.846e-1349.45AIG2-like domain-containing protein 1 OS=Rattus no... [more]
A2LD1_MOUSE1.844e-1251.22AIG2-like domain-containing protein 1 OS=Mus muscu... [more]
A2LD1_HUMAN5.366e-1247.56AIG2-like domain-containing protein 1 OS=Homo sapi... [more]
A2LD1_BOVIN7.749e-1147.56AIG2-like domain-containing protein 1 OS=Bos tauru... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_01I02_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01I02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835573 ID=CF835573|Name=CF835573|organism=Citrus sinensis|type=EST|length=784bp
CTTCCCCCCTAGATATTATATTATATCATTCATTCATTCGGCGTCAGTCG
AATACAATTCAGTTTTGTCGAATAAAAATGGGAATGGAAGTGGCAGCGGA
AGAAGAGCCGAAGAAGAAGTGTCGGGCTCTGATATTCACGTACGGGACGC
TGAAGCGGGGCTTCTCGAACCACAACCTGATCCAAGATCTAATGCTCACC
GGCGACGCCGTTTTCAGAGGCGCCTACACCACCTCCGAGAGCTTCCCCCT
CGTCTGCGGGCCCTACCGCGTCCCTTTCCTCCTCAACATCCCCGGCTCCG
GCCACCCCGTCACCGGCGAGCTCTACGCCGTCTCCGCCTACGGCCTCTCC
AGGATGGACGAGCTCGAAGGCACCTCCCGCGGCCACTACCAAAGGCTCGG
CCCCATCAGAGTAACCAAGGCGGCGGCGGCGGAGGAGGCCGACGATGACT
CCGACGATGAAGCCGAGGCTGAGGCTGAGGCTTATTTTGCGGACAGGAGC
TACGAAATGGAGCTGTGGAAGAAGAGCGGGAAGTTAGGGTTTCGTTGGTA
TGGCGAAAAAGAAGCCAAAGGCTACGTTAAGAGGAAAGATCGCCCCCAGA
ATCTCTCTTTCCTGGAACATATTCGCATCTTTCTTTCATCCTCCACCGAT
CAATGATTCTTATATTTATTATCCGTCATGTTATAATTTTAATCCTTATT
AGTTAGTGCTCTGGATCTATACTTTTTTTTTTATTTTCAAAATCTATAAT
TTTGTTGTTAATTAGCTCTTTAGAGGATGATGAT
back to top