CF835577

Overview
NameCF835577
Unique NameCF835577
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length803
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7838 contig Csv1_Contig7838:900..1696. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA_PRUDU (Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 2.915e-93
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA1_PEA (Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 2.915e-93
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA1_ANEPH (Tubulin alpha-1 chain OS=Anemia phyllitidis GN=TUBA1 PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 6.493e-93
Identity = 164/165 (99.39%), Postives = 165/165 (100.00%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA4_GOSHI (Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 8.480e-93
Identity = 164/165 (99.39%), Postives = 164/165 (99.39%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA1_GOSHI (Tubulin alpha-1 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 8.480e-93
Identity = 164/165 (99.39%), Postives = 164/165 (99.39%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQF DWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA2_GOSHI (Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 1.108e-92
Identity = 163/165 (98.79%), Postives = 165/165 (100.00%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAF+HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA3_HORVU (Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 2.467e-92
Identity = 163/165 (98.79%), Postives = 164/165 (99.39%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA2_MAIZE (Tubulin alpha-2 chain OS=Zea mays GN=TUBA2 PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 2.467e-92
Identity = 163/165 (98.79%), Postives = 164/165 (99.39%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA1_MAIZE (Tubulin alpha-1 chain OS=Zea mays GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 2.467e-92
Identity = 163/165 (98.79%), Postives = 164/165 (99.39%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835577 vs. ExPASy Swiss-Prot
Match: TBA1_ELEIN (Tubulin alpha-1 chain OS=Eleusine indica GN=TUBA1 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 2.467e-92
Identity = 163/165 (98.79%), Postives = 164/165 (99.39%), Query Frame = -1
Query:  309 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 803
            MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  268 MLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
The following BLAST results are available for this feature:
BLAST of CF835577 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 380
Match NameE-valueIdentityDescription
TBA_PRUDU2.915e-93100.00Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 ... [more]
TBA1_PEA2.915e-93100.00Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE... [more]
TBA1_ANEPH6.493e-9399.39Tubulin alpha-1 chain OS=Anemia phyllitidis GN=TUB... [more]
TBA4_GOSHI8.480e-9399.39Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA1_GOSHI8.480e-9399.39Tubulin alpha-1 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA2_GOSHI1.108e-9298.79Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA3_HORVU2.467e-9298.79Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 ... [more]
TBA2_MAIZE2.467e-9298.79Tubulin alpha-2 chain OS=Zea mays GN=TUBA2 PE=3 SV... [more]
TBA1_MAIZE2.467e-9298.79Tubulin alpha-1 chain OS=Zea mays GN=TUBA1 PE=3 SV... [more]
TBA1_ELEIN2.467e-9298.79Tubulin alpha-1 chain OS=Eleusine indica GN=TUBA1 ... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_01I05_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01I05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835577 ID=CF835577|Name=CF835577|organism=Citrus sinensis|type=EST|length=803bp
TTTTTTTAGACAACCCCCGAAGCTATGTTGTAAATTGAAATAAGATAACC
CTATAAAAATCAAACAGTCAAAGATTACATGAACATATACCTTCCATAAA
CTTGATAAGCATAACAAATTTCAACAAGCTTTGAAATTGAGCGAGAATCA
AAGAGAGGAATAAGGTTTTCAACACAAAATAAAGGCACGAAGCGTCACTA
AAGCACAAGACATCATACTAAAACGCACAGATAATTGCACACTTAGATCC
CTCAGTCCTCCTCACCATAATCTTCCTCGCCCTCGGCAGACTCTGCACCC
ACCTCCTCATAATCCTTCTCAAGGGCAGCAAGATCCTCACGAGCCTCAGA
GAACTCTCCTTCTTCCATACCCTCGCCAACATACCAGTGGACGAAAGCAC
GCTTTGCATACATAAGATCAAACTTGTGGTCAATGCGAGAGAACACCTCT
GCCACACTGGTGGAGTTGGAGATCATGCAAACAGCCCTCTGCACCTTGGC
AAGGTCACCACCAGGAACAACAGTTGGTGGCTGGTAGTTGATACCACACT
TGAACCCAGTCGGGCACCAGTCGACGAATTGGATTGTACGCTTGGTCTTG
ATGGTAGCAACAGCTGCATTGACATCCTTGGGCACAACATCACCACGGTA
CATGAGGCAGCAAGCCATGTACTTGCCATGACGAGGATCACATTTGGCCA
TCATAGATGAGGGCTCAAAGGCACTGTTGGTGATCTCAGCAACTGAGAGT
TGTTCATGGTAGGCCTTCTCAGCTGAGATGACTGGTGCATAGGAGGAAAG
CAT
back to top