CF835580

Overview
NameCF835580
Unique NameCF835580
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length736
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835580 vs. ExPASy Swiss-Prot
Match: YUID_BACSU (Uncharacterized membrane protein yuiD OS=Bacillus subtilis GN=yuiD PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.665e-18
Identity = 46/122 (37.70%), Postives = 73/122 (59.84%), Query Frame = 2
Query:   98 KRWDSKKMLDSGGMPSSHSATVSALAVAIGLQEGSGSPSFAIAVVLACIVMYDASGVRLHAGRQAELLNQIVC----------EFPPDHPLSSVRPLRELLGHTPLQVVAGGILGCVVAFLM 433
            ++ D   +  +GGMPSSHSA V+AL+  + L+ G  S  FA++ + A I M+DA+GVR HAG QA ++N++V           +FP        + L+ELLGH P++V  GG+ G ++  ++
Sbjct:   32 RKLDWSLVTSTGGMPSSHSAAVTALSTGVALEHGLDSSLFAVSAIFAVITMFDATGVRRHAGEQATVINKLVIDFNRFVNEAKDFPKAAEKEKQKKLKELLGHQPIEVFFGGLTGILLTLVL 153          
The following BLAST results are available for this feature:
BLAST of CF835580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
YUID_BACSU2.665e-1837.70Uncharacterized membrane protein yuiD OS=Bacillus ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01I06_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01I06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835580 ID=CF835580; Name=CF835580; organism=Citrus sinensis; type=EST; length=736bp
AGCGCTGTTCTTCCCTAACAACCTCCCTCTGATCTCCGCATTTCTCGCCT
TTGCTCTTGCTCAATTCCTCAAGATCTTCACCACTTGGTATAAAGAAAAG
AGATGGGATTCTAAAAAGATGCTTGACTCTGGTGGAATGCCTTCGTCACA
TTCTGCTACTGTGTCGGCTCTAGCAGTAGCTATTGGTCTGCAAGAAGGGT
CAGGAAGTCCATCTTTTGCCATTGCAGTGGTCTTGGCTTGCATTGTAATG
TATGATGCCTCTGGGGTCAGACTACATGCTGGTCGGCAAGCTGAATTGCT
GAATCAAATAGTATGTGAGTTTCCTCCAGACCACCCATTGTCTAGCGTTA
GACCTCTACGTGAATTACTTGGTCATACCCCGTTACAGGTTGTGGCCGGT
GGTATTTTGGGATGCGTTGTAGCGTTTCTGATGAGAAACTCGAACTAGAT
CATTACAAGATCAACATTGATTATTTGTTTCGTCTCCAATTGGCCGATAA
CCTGGTAGATATAGGCAGCAGCTCGGCTGGGAGATACAAGTGACCTAAAC
AGATGTATAATGTATTCAGTCGTTATTCTGTAGTGATTTTGGGGTTTATT
TGGAGACTGGATGACTATGTTTTTTTGTTAACCTAGAACTTCATTTTGTA
AACTTAAAACCTCTGTTAATAAACGTCACTTAAAACCTCTGTTAACTTAA
TAAACGTCACTTCTTTCCTTTTTCGAAAAAAAAAAA
back to top