CF835592

Overview
NameCF835592
Unique NameCF835592
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length711
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3618 contig Csv1_Contig3618:92..802. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: QORL2_NEMVE (Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.618e-25
Identity = 77/236 (32.63%), Postives = 120/236 (50.85%), Query Frame = 1
Query:    7 RTPLEALVCRKLGDPTLSIHDEKSPILLSKTEPIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAAL-GSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQI-GKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYDPVGG 708
            R    A++C +LG P L + D+ S      TE +     ++ VRV V +  +N+A+ L+ +GKYQEKP LPFVPG++ SG V  VG  V++   GD V G     G  A+  V  Q+ L+ +P       AAAL +++GT+++ L H+A L  GQ                 +   V GA +I  +R  EK+  ++ +G    +D + E++   VKE        G +V+ + VGG
Sbjct:   36 RKSYRAVMCNELGKP-LVVEDKFS------TENL----GTSQVRVAVHSCGINFADILKCIGKYQEKPELPFVPGTEISGEVVEVGSKVTSLSKGDRVLGVCGQGGGMAEECVLPQTALWKIPSSLSFTQAAALAISYGTAYIGLKHKANLQPGQTVLVTAAAGALGLASVDLAANVFGAKVIGASR-KEKLVIVQEIGATATIDYTRENIKDKVKELTDGH---GANVIMEAVGG 256          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: QORL2_RAT (Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.032e-25
Identity = 74/213 (34.74%), Postives = 107/213 (50.23%), Query Frame = 1
Query:   73 KSPILLSKTEPIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIG-KVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYDPVGG 708
            K P+ + +  P P       VRV V    +N+A+ L   G+YQEKPPLPF PG ++SG V   G +VS  K GD V G +   S A+  + DQ  L+ +P+   L  AA LPV++GT+ +A+ HRA++  G+                 +   V  A +IA A   EK K     G    V+ S  S+  +VK+ + +    GV+V  D VGG
Sbjct:   36 KQPLTIQEVAPRPI--GPQEVRVDVHFCGINFADNLVCRGQYQEKPPLPFTPGMEFSGVVLEAGADVSTVKKGDRVIGVSNFHSMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAILAVDHRARIQPGETVLVTAAAGATGLAVIDVATNVFCAKVIAAAGSDEKCKLAMQRGAQSGVNYSQGSLKDAVKKLVGS---SGVNVAIDMVGG 243          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: QORL2_MOUSE (Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.052e-24
Identity = 73/213 (34.27%), Postives = 105/213 (49.30%), Query Frame = 1
Query:   73 KSPILLSKTEPIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIG-KVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYDPVGG 708
            K P+ + +  P P       VRV V    +N+A+ L   G+YQEKPPLPF PG ++SG V   G +VS  K GD V G ++  + A+  + DQ  L+ +P+   L  AA LPV++GT+ +A+ HRA++  G+                 +   V  A +IA     EK K     G    V+ S  S+  +VK   K     GV+V  D VGG
Sbjct:   36 KQPLTIQEVAPRPV--GPQEVRVDVHFCGVNFADILACRGQYQEKPPLPFTPGMEFSGAVLETGTDVSTVKKGDRVIGVSSFHAMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAILAVDHRARIQPGETVLVTAAAGATGLAVIDVATNVFRAKVIAATGSDEKCKLAVQRGAQFSVNYSQGSLRDAVK---KLAGSGGVNVAIDMVGG 243          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: QORL2_BOVIN (Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 3.158e-21
Identity = 68/213 (31.92%), Postives = 101/213 (47.42%), Query Frame = 1
Query:   73 KSPILLSKTEPIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIG-KVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYDPVGG 708
            K P+++ +  P P       VRV V    +N+A+ L   G+YQE+  LPF PG ++SG V   G +VS  K GD V G       A+  + D   L+ +P+   L  AAALPV++GT+  AL HRA    G+                 +   +  A +IA A   EK +     G    V+ S  S+  +V + + +    GV+V+ D VGG
Sbjct:   35 KRPLVIEEVTPRPV--QPHEVRVNVHFCGINFADILACQGQYQERHQLPFTPGMEFSGMVLETGTDVSTVKEGDRVIGLPGFSGMAEECITDHKNLWQIPEKVSLREAAALPVSYGTAIFALEHRACTQPGETVLVTAAAGATGLAVIDVATNILQAKVIAAAGSDEKCQLAMQSGAQSSVNYSRGSLKEAVGKLVGS---GGVNVVIDMVGG 242          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: QOR_MOUSE (Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.242e-17
Identity = 60/199 (30.15%), Postives = 93/199 (46.73%), Query Frame = 1
Query:  103 PIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTV-CGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYD 696
            P+PQ   S  V ++V A  +N        G Y  KP LP+ PGSD +G +++VG  VS FK GD V C     G +A+F +A    ++P+P+  +    AAL + + T+  AL H A+  +G+                QI +  G  ++  A   E  K +   G   V +    + I  +K  +   K KGVDV+ +
Sbjct:   31 PVPQ---SHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKVSAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSV-GDKDKGVDVIIE 225          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: VAT1_DANRE (Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.119e-17
Identity = 57/195 (29.23%), Postives = 87/195 (44.62%), Query Frame = 1
Query:  124 STAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYDPVGG 708
            S  V VRVK   LN+A+ +   G Y   P  P  PG + SG ++AVG  V++ KVGD V      G + + +V   +  F +P+G     AAALPV + T+++ L     L   Q                Q+ K      +     A K + +   GV H +D      +  V++       KG+D++ DP+GG
Sbjct:   98 SGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPGMECSGVIEAVGEEVTDRKVGDKVLVLNRSGMWQEVVVVASTHTFLMPEGMSFEEAAALPVNYITAYMMLFDFGHLRPNQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTASASKHEVISQGGVTHPIDYRTRDYVEEVRKI----SPKGLDIVLDPLGG 288          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: QOR_RAT (Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.614e-17
Identity = 60/204 (29.41%), Postives = 95/204 (46.57%), Query Frame = 1
Query:  103 PIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAAL-GSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYDPVGGK 711
            P PQ   S  V ++V A  +N        G Y  KP LP+ PGSD +G +++VG  VS FK GD V  F+ + G +A+F ++  +  +P+P+  D    AAL + + T+  AL H A+  +G+                QI +  G  ++  A   E  K +   G   V +    + I  +K    +   KGVDV+ + +  K
Sbjct:   31 PAPQ---SHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVAGIIESVGDGVSAFKKGDRVFCFSTVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIK---TSAGDKGVDVIIEMLANK 228          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: QOR_PONAB (Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.793e-16
Identity = 54/199 (27.14%), Postives = 96/199 (48.24%), Query Frame = 1
Query:  103 PIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAAL-GSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYD 696
            PIP+ + +    ++V A  +N        G Y  KP LP+ PGSD +G ++AVG N S FK GD V   + + G +A++ +A    ++ +P+  D    AA+ + + T++ AL+H A + +G+                QI +  G  ++  A   E  K +   G   V +    + I  +K+++     KG+DV+ +
Sbjct:   31 PIPKDHQAL---IKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGGNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSAHVKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGE---KGIDVIIE 223          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: QOR_HUMAN (Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.793e-16
Identity = 55/199 (27.64%), Postives = 96/199 (48.24%), Query Frame = 1
Query:  103 PIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAAL-GSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDVLYD 696
            PIP+ +    V ++V A  +N        G Y  KP LP+ PGSD +G ++AVG N S FK GD V   + + G +A++ +A    ++ +P+  D    AA+ + + T++ AL+H A + +G+                QI +  G  I+  A   E  K +   G   V +    + I  +K+++     KG+D++ +
Sbjct:   31 PIPKDHQ---VLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGE---KGIDIIIE 223          
BLAST of CF835592 vs. ExPASy Swiss-Prot
Match: ERYA2_SACER (Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 1.793e-16
Identity = 71/213 (33.33%), Postives = 103/213 (48.36%), Query Frame = 1
Query:  100 EPIPQLNS---STAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKL------KGVDVLYDPVGGK 711
            EP P +     +  VRV V+AT +N+ + L  LG Y +K  +    G++ +G V AVGP+V  F  GD V G    G+FA   V D   L  VP G     AAA+P+A+ T+H AL   A L +GQ                 + +  GA ++A A G  K   L++LG+D       +  I S +E   ARK       +GVDV+ + + G+
Sbjct: 2839 EPAPDVEQPLRAGEVRVDVRATGVNFRDVLLALGMYPQKADM----GTEAAGVVTAVGPDVDAFAPGDRVLGLFQ-GAFAPIAVTDHRLLARVPDGWSDADAAAVPIAYTTAHYALHDLAGLRAGQSVLIHAAAGGVGMAAVALARRAGAEVLATA-GPAKHGTLRALGLD-------DEHIASSRETGFARKFRERTGGRGVDVVLNSLTGE 3038          
The following BLAST results are available for this feature:
BLAST of CF835592 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
QORL2_NEMVE1.618e-2532.63Quinone oxidoreductase-like protein 2 homolog OS=N... [more]
QORL2_RAT8.032e-2534.74Quinone oxidoreductase-like protein 2 OS=Rattus no... [more]
QORL2_MOUSE3.052e-2434.27Quinone oxidoreductase-like protein 2 OS=Mus muscu... [more]
QORL2_BOVIN3.158e-2131.92Quinone oxidoreductase-like protein 2 OS=Bos tauru... [more]
QOR_MOUSE1.242e-1730.15Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=... [more]
VAT1_DANRE2.119e-1729.23Synaptic vesicle membrane protein VAT-1 homolog OS... [more]
QOR_RAT3.614e-1729.41Quinone oxidoreductase OS=Rattus norvegicus GN=Cry... [more]
QOR_PONAB1.793e-1627.14Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=... [more]
QOR_HUMAN1.793e-1627.64Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=... [more]
ERYA2_SACER1.793e-1633.33Erythronolide synthase, modules 3 and 4 OS=Sacchar... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_01I12_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01I12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835592 ID=CF835592|Name=CF835592|organism=Citrus sinensis|type=EST|length=711bp
TTGACTCGAACCCCGTTGGAGGCACTGGTGTGCAGGAAACTGGGCGATCC
AACCCTCTCAATTCACGATGAAAAATCGCCGATTCTGTTGAGTAAAACTG
AGCCAATTCCACAATTGAATTCTTCAACTGCAGTTAGAGTCAGAGTGAAA
GCCACCAGCTTGAACTACGCTAATTACTTGCAGATATTGGGGAAATATCA
AGAGAAACCACCATTGCCCTTCGTCCCCGGCTCCGATTATTCGGGCACTG
TTGATGCGGTGGGCCCCAATGTCTCAAATTTCAAAGTGGGTGACACTGTT
TGTGGATTTGCTGCCCTTGGCTCCTTTGCCCAATTCATCGTCGCTGATCA
GTCAGAATTGTTTCCAGTGCCAAAGGGATGTGATTTGTTGGCTGCTGCTG
CACTTCCTGTTGCATTTGGAACCTCACATGTTGCTCTTGTTCATCGGGCC
CAATTGTCCTCCGGTCAGGTCTTGCTTGTTCTTGGTGCTGCTGGAGGTGT
TGGTGTTGCCGCTGTTCAAATTGGCAAGGTTTGCGGAGCCACTATCATTG
CCGTTGCTAGGGGTGCTGAAAAGATAAAATTTTTGAAGTCATTGGGCGTC
GATCATGTAGTTGACTTGAGCAATGAGAGTGTCATTCCGAGTGTCAAAGA
GTTCCTCAAGGCAAGGAAACTCAAAGGGGTTGATGTTCTGTATGATCCTG
TTGGAGGCAAG
back to top