CF835703

Overview
NameCF835703
Unique NameCF835703
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length823
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6651 contig Csv1_Contig6651:220..1042. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835703 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 2.064e-57
Identity = 104/214 (48.60%), Postives = 143/214 (66.82%), Query Frame = -1
Query:   86 LSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 727
            L C +WR  VETNN+  W T+PE+CA YV  YM+G  Y+M+ + V++EA  YA+S+ L  DG+++W+FD+DET LSNLPYY+ + +G++ ++   F++WV  G A               LG K+  LTGR E  R+VT  NL +AGF  W KLIL+GS   G+TA  YKS  R  +  +G+RI+GN GDQWSDLLG++   R+FKLP+PMYYI
Sbjct:   41 LKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPYYSDHRYGLEVFDDVEFDKWVENGTAPALGSSLKLYQEVLKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI 254          
BLAST of CF835703 vs. ExPASy Swiss-Prot
Match: VSPA_SOYBN (Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.252e-54
Identity = 110/218 (50.46%), Postives = 146/218 (66.97%), Query Frame = -1
Query:   86 PGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKG-SSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDPMYYI 733
            P + C SWRL VE +N+ G+ T+PE+C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY K+G+GV+ +N TL++EWVN G A               LG KI+FL+GR  D++ VTEANLK AG+ TWEKLILK     S   AV YK++ R+KL  +GY I+G IGDQWSDLLG + G +RTFKLP+P+YYI
Sbjct:   38 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNPLYYI 253          
BLAST of CF835703 vs. ExPASy Swiss-Prot
Match: S25K_SOYBN (Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 2.611e-52
Identity = 107/214 (50.00%), Postives = 142/214 (66.36%), Query Frame = -1
Query:   98 PGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKG-SSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDP 733
            P + C SWRL VE +N+ G+ T+PE+C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY K+G+GV+ +N TL++EWVN G A               LG KI+FL+GR  D++ VTEANLK AG+ TWEKLILK     S   AV YK++ R+KL  +GY I+G IGDQWSDLLG + G +RTFKLP+P
Sbjct:   35 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNP 246          
BLAST of CF835703 vs. ExPASy Swiss-Prot
Match: VSPB_SOYBN (Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 4.924e-51
Identity = 108/224 (48.21%), Postives = 146/224 (65.18%), Query Frame = -1
Query:   86 GSRNNDVPGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDPMYYI 754
            G R+++V    C S+RL VE +N+  + T+PE+C      Y+ G+Q+R DS+ V  +A  YA   ++  +  +I++F ID T LSN+PYY K+G+GV+ +N TL++EWVN G A               LG KIVFL+GR  D+  VTEANLK AGF TWE+LILK        A+ YKS+ R+ L  +GYRI+G IGDQWSDLLG + G +RTFKLP+PMYYI
Sbjct:   35 GERSSEV---KCASFRLAVEAHNIRAFKTIPEECVEPTKDYINGEQFRSDSKTVNQQAFFYASEREVHHN--DIFIFGIDNTVLSNIPYYEKHGYGVEEFNETLYDEWVNKGDAPALPETLKNYNKLLSLGFKIVFLSGRYLDKMAVTEANLKKAGFHTWEQLILKDPHLITPNALSYKSAMRENLLRQGYRIVGIIGDQWSDLLGDHRGESRTFKLPNPMYYI 253          
BLAST of CF835703 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.830e-44
Identity = 96/215 (44.65%), Postives = 131/215 (60.93%), Query Frame = -1
Query:   86 SCLSWRLGVETNNVIGWATVPEKCAGYVGHYML-GQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTG-KAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 724
            +C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYAK G+G +  +P  +  W+ TG                  LGI+ + L+ R +  +NVT  NL+ AG   W+ LILK +  S    VVYKS  RK L  KGY I+GNIGDQW+DL+    G R FKLP+P+YY+
Sbjct:   51 NCRSWHLGVETSNIIDFDTVPANCKDYVEDYLITSKQYQYDSKTVCKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTEKTDPGAYWLWLGTGASTPGLPEALHLYQNIIELGIEPIILSDRWKLWKNVTLDNLEAAGVTYWKHLILKPNG-SNLRQVVYKSKVRKSLVKKGYNIVGNIGDQWADLVEDTPG-RVFKLPNPLYYV 263          
BLAST of CF835703 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 6.446e-43
Identity = 93/215 (43.26%), Postives = 129/215 (60.00%), Query Frame = -1
Query:   86 SCLSWRLGVETNNVIGWATVPEKCAGYVGHYML-GQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKA-XXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 724
            +C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYAK G+G +   P  +  W+ +G++                LGI+ + ++ R +    VT  NLK  G   W+ LILK +  S  T VVYKS  R  L  KGY I+GNIGDQW+DL+    G R FKLP+P+YY+
Sbjct:   56 NCRSWHLGVETSNIINFDTVPANCKAYVEDYLITSKQYQYDSKTVNKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTENTAPGAYWSWLESGESTPGLPETLHLYENLLELGIEPIIISDRWKKLSEVTVENLKAVGVTKWKHLILKPNG-SKLTQVVYKSKVRNSLVKKGYNIVGNIGDQWADLVEDTPG-RVFKLPNPLYYV 268          
The following BLAST results are available for this feature:
BLAST of CF835703 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PPA1_SOLLC2.064e-5748.60Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1... [more]
VSPA_SOYBN1.252e-5450.46Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE... [more]
S25K_SOYBN2.611e-5250.00Stem 31 kDa glycoprotein (Fragment) OS=Glycine max... [more]
VSPB_SOYBN4.924e-5148.21Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE... [more]
VSP2_ARATH5.830e-4444.65Vegetative storage protein 2 OS=Arabidopsis thalia... [more]
VSP1_ARATH6.446e-4343.26Vegetative storage protein 1 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01L21_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01L21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835703 ID=CF835703|Name=CF835703|organism=Citrus sinensis|type=EST|length=823bp
TTTTTTTTTTTTTTTTTGGTGCACAAATGAAGGCCCTTCGATTATTTATT
CAAAATCCCAAGTAAACATTATTTATTAATTAGCCAATGTAATACATTGG
GTCAGGCAGCTTGAACGTCCGATTGCCGGCGTTGGTGCCCAGGAGATCGC
TCCATTGATCACCTATGTTTCCAATAATTCTGTACCCTTTCATCTCAAGC
TTCTTTCTTTCACTTGATTTGTACACCACTGCTGTTTCTCCTGAGTGAGA
TGATCCCTTGAGGATGAGCTTCTCCCAGGTGTCGAATCCAGCATGCTTTA
AATTAGCTTCTGTAACATTTCTCTGATCTTCTGGTCTTCCCGTGAGGAAT
ACAATCTTAATTCCAAGCAATAATAATTTTTTGTAAAGCTTAAGGCTCTC
TGGCAGCGGTGGTGCTTTTCCGGTGTTCACCCATTCATTAAACAAAGTAG
GGTTGTATGGCTTCACCCCGAATCCATTCTTAGCATAATATGGCAAATTA
GATAGCGAGGTTTCATCTATGTCGAAAACCCAAATGTTCTTGCCGTCGCC
AGCAAGCTTGAGGCTCTGCGCATAGAGAATGGCCTCATTAGCTACCACTT
CAGAGTCCATGCGGTACTGCTGGCCTAACATGTAATGCCCCACGTAGCCT
GCACATTTTTCGGGAACAGTCGCCCATCCTATAACGTTATTAGTTTCCAC
TCCGAGTCGCCAACTCAGGCAGGACAAGCCGGGAACATCGTTGTTCCGGG
AACCGGCTTTCGGTCGGAGAAGATGAATCTGATGGGGGATGTCCATGCTA
AATCCATGGGATGTTGCTGATAT
back to top