CF835704

Overview
NameCF835704
Unique NameCF835704
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6651 contig Csv1_Contig6651:101..865. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835704 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 6.302e-42
Identity = 80/183 (43.72%), Postives = 114/183 (62.30%), Query Frame = 3
Query:  216 LSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSXETAVVYKSSERKKLEMKGYR 764
            L C +WR  VETNN+  W T+PE+CA YV  YM+G  Y+M+ + V++EA  YA+S+ L  DG+++W+FD+DET LSNLPYY+ + +G++ ++   F++WV  G A                G K+  LTGR E  R+VT  NL +AGF  W KLIL+GS    +TA  YKS  R  +  +G+R
Sbjct:   41 LKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPYYSDHRYGLEVFDDVEFDKWVENGTAPALGSSLKLYQEVLKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEGFR 223          
BLAST of CF835704 vs. ExPASy Swiss-Prot
Match: VSPA_SOYBN (Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 5.335e-41
Identity = 86/185 (46.49%), Postives = 117/185 (63.24%), Query Frame = 3
Query:  210 PGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKG-SSHSXETAVVYKSSERKKLEMKGY 761
            P + C SWRL VE +N+ G+ T+PE+C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY K+G+GV+ +N TL++EWVN G A                G KI+FL+GR  D++ VTEANLK AG+ TWEKLILK     S   AV YK++ R+KL  +GY
Sbjct:   38 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGY 220          
BLAST of CF835704 vs. ExPASy Swiss-Prot
Match: S25K_SOYBN (Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 5.335e-41
Identity = 86/185 (46.49%), Postives = 117/185 (63.24%), Query Frame = 3
Query:  210 PGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKG-SSHSXETAVVYKSSERKKLEMKGY 761
            P + C SWRL VE +N+ G+ T+PE+C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY K+G+GV+ +N TL++EWVN G A                G KI+FL+GR  D++ VTEANLK AG+ TWEKLILK     S   AV YK++ R+KL  +GY
Sbjct:   35 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGY 217          
BLAST of CF835704 vs. ExPASy Swiss-Prot
Match: VSPB_SOYBN (Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 6.104e-37
Identity = 83/192 (43.23%), Postives = 117/192 (60.94%), Query Frame = 3
Query:  189 GSRNNDVPGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSXETAVVYKSSERKKLEMKGYR 764
            G R+++V    C S+RL VE +N+  + T+PE+C      Y+ G+Q+R DS+ V  +A  YA   ++  +  +I++F ID T LSN+PYY K+G+GV+ +N TL++EWVN G A                G KIVFL+GR  D+  VTEANLK AGF TWE+LILK        A+ YKS+ R+ L  +GYR
Sbjct:   35 GERSSEV---KCASFRLAVEAHNIRAFKTIPEECVEPTKDYINGEQFRSDSKTVNQQAFFYASEREVHHN--DIFIFGIDNTVLSNIPYYEKHGYGVEEFNETLYDEWVNKGDAPALPETLKNYNKLLSLGFKIVFLSGRYLDKMAVTEANLKKAGFHTWEQLILKDPHLITPNALSYKSAMRENLLRQGYR 221          
BLAST of CF835704 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.720e-31
Identity = 76/183 (41.53%), Postives = 105/183 (57.38%), Query Frame = 3
Query:  219 SCLSWRLGVETNNVIGWATVPEKCAGYVGHYML-GQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTG-KAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSXETAVVYKSSERKKLEMKGY 761
            +C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYAK G+G +  +P  +  W+ TG                   GI+ + L+ R +  +NVT  NL+ AG   W+ LILK +  S    VVYKS  RK L  KGY
Sbjct:   51 NCRSWHLGVETSNIIDFDTVPANCKDYVEDYLITSKQYQYDSKTVCKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTEKTDPGAYWLWLGTGASTPGLPEALHLYQNIIELGIEPIILSDRWKLWKNVTLDNLEAAGVTYWKHLILKPNG-SNLRQVVYKSKVRKSLVKKGY 232          
BLAST of CF835704 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 2.934e-31
Identity = 87/236 (36.86%), Postives = 121/236 (51.27%), Query Frame = 3
Query:   87 SMDIRHLFLATISATSHGFSMDIPHQIHLLRPKAGSRNN----DVPGLS-----CLSWRLGVETNNVIGWATVPEKCAGYVGHYML-GQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKA-XXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSXETAVVYKSSERKKLEMKGY 761
            S+ +  L  AT+S      S  +P  I LL       N     +  GLS     C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYAK G+G +   P  +  W+ +G++                 GI+ + ++ R +    VT  NLK  G   W+ LILK +  S  T VVYKS  R  L  KGY
Sbjct:    5 SLSLLLLLAATVSHVQS--SASVPGLIELLESNTIFGNEAELLEKEGLSINYPNCRSWHLGVETSNIINFDTVPANCKAYVEDYLITSKQYQYDSKTVNKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTENTAPGAYWSWLESGESTPGLPETLHLYENLLELGIEPIIISDRWKKLSEVTVENLKAVGVTKWKHLILKPNG-SKLTQVVYKSKVRNSLVKKGY 237          
The following BLAST results are available for this feature:
BLAST of CF835704 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PPA1_SOLLC6.302e-4243.72Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1... [more]
VSPA_SOYBN5.335e-4146.49Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE... [more]
S25K_SOYBN5.335e-4146.49Stem 31 kDa glycoprotein (Fragment) OS=Glycine max... [more]
VSPB_SOYBN6.104e-3743.23Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE... [more]
VSP2_ARATH1.720e-3141.53Vegetative storage protein 2 OS=Arabidopsis thalia... [more]
VSP1_ARATH2.934e-3136.86Vegetative storage protein 1 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01L21_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01L21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835704 ID=CF835704|Name=CF835704|organism=Citrus sinensis|type=EST|length=765bp
TTACAGTTGTACCGAGCATGGGAGGGGTGTCACTGCCATTATTCTTCTTT
TTTCTGGCTACCATATCAGCAACATCCCATGGATTTAGCATGGACATCCG
CCATCTTTTTCTGGCTACCATATCAGCAACATCCCATGGATTTAGCATGG
ACATCCCCCATCAGATTCATCTTCTCCGACCGAAAGCCGGTTCCCGGAAC
AACGATGTTCCCGGCTTGTCCTGCCTGAGTTGGCGACTCGGAGTGGAAAC
TAATAACGTTATAGGATGGGCGACTGTTCCCGAAAAATGTGCAGGCTACG
TGGGGCATTACATGTTAGGCCAGCAGTACCGCATGGACTCTGAAGTGGTA
GCTAATGAGGCCATTCTCTATGCGCAGAGCCTCAAGCTTGCTGGCGACGG
CAAGAACATTTGGGTTTTCGACATAGATGAAACCTCGCTATCTAATTTGC
CATATTATGCTAAGAATGGATTCGGGGTGAAGCCATACAACCCTACTTTG
TTTAATGAATGGGTGAACACCGGAAAAGCACCACCGCTGCCAGAGAGCCT
TAAGCTTTACAAAAAATTATTATTGCTTGGAATTAAGATTGTATTCCTCA
CGGGAAGACCAGAAGATCAGAGAAATGTTACAGAAGCTAATTTAAAGCAT
GCTGGATTCGACACCTGGGAGAAGCTCATCCTCAAGGGATCATCTCACTC
ANGAGAAACAGCAGTGGTGTACAAATCAAGTGAAAGAAAGAAGCTTGAGA
TGAAAGGGTACAGAA
back to top