CF835708

Overview
NameCF835708
Unique NameCF835708
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length834
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF835708_ssr372 microsatellite CF835708_ssr372:372..383. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: FOGT1_ARATH (Flavonol-3-O-glycoside-7-O-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT73C6 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.968e-55
Identity = 108/189 (57.14%), Postives = 136/189 (71.96%), Query Frame = -2
Query:  267 LIELGLGLEASKKPFIWVTRVGSKXXXXXXXXXXXXXXERIKGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSSYNHIKLFIQDIMQQPSS 833
            L+ELGLGLE S++PFIWV R   K              +RI+  GLLI+GW+PQ++ILSHP+VGGFLTHCGWNS+LEGI+AG+ MLTWPLFADQFCNEKL+V++L++GV   V+  MK+GEEEKIGVLV KE V+ A+  LM            AKE GE A +A+EEGGSS+++I   +QDIMQ   S
Sbjct:  305 LLELGLGLEESQRPFIWVIRGWEKYKELVEWFSESGFEDRIQDRGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPMLTWPLFADQFCNEKLVVQILKVGVSAEVKEVMKWGEEEKIGVLVDKEGVKKAVEELMGESDDAKERRRRAKELGESAHKAVEEGGSSHSNITFLLQDIMQLAQS 493          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: COGT3_ARATH (Cytokinin-O-glucosyltransferase 3 OS=Arabidopsis thaliana GN=UGT73C5 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.968e-55
Identity = 108/185 (58.38%), Postives = 135/185 (72.97%), Query Frame = -2
Query:  279 LIELGLGLEASKKPFIWVTRVGSKXXXXXXXXXXXXXXERIKGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSSYNHIKLFIQDIMQ 833
            L ELGLGLE S++PFIWV R   K              +RI+  GLLI+GW+PQ++ILSHP+VGGFLTHCGWNS+LEGI+AG+ +LTWPLFADQFCNEKL+V+VL+ GV  GVE PMK+GEEEKIGVLV KE V+ A+  LM            AKE G+ A +A+EEGGSS+++I   +QDIM+
Sbjct:  305 LKELGLGLEESQRPFIWVIRGWEKYKELVEWFSESGFEDRIQDRGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPLLTWPLFADQFCNEKLVVEVLKAGVRSGVEQPMKWGEEEKIGVLVDKEGVKKAVEELMGESDDAKERRRRAKELGDSAHKAVEEGGSSHSNISFLLQDIME 489          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: COGT1_ARATH (Cytokinin-O-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT73C1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.276e-54
Identity = 108/185 (58.38%), Postives = 131/185 (70.81%), Query Frame = -2
Query:  279 LIELGLGLEASKKPFIWVTRVGSKXXXXXXXXXXXXXXERIKGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSSYNHIKLFIQDIMQ 833
            L ELGLGLE S++PFIWV R   K              ERIK  GLLI GW+PQ++IL+HPAVGGFLTHCGWNS+LEGI++GV +LTWPLF DQFCNEKL V++L+ GV  GVE  M++GEEEKIGVLV KE V+ A+  LM             KE GELA +A+EEGGSS+++I   +QDIMQ
Sbjct:  301 LKELGLGLEESQRPFIWVIRGWEKYNELLEWISESGYKERIKERGLLITGWSPQMLILTHPAVGGFLTHCGWNSTLEGITSGVPLLTWPLFGDQFCNEKLAVQILKAGVRAGVEESMRWGEEEKIGVLVDKEGVKKAVEELMGDSNDAKERRKRVKELGELAHKAVEEGGSSHSNITFLLQDIMQ 485          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: UFOG4_MANES (Anthocyanidin 3-O-glucosyltransferase 4 (Fragment) OS=Manihot esculenta GN=GT4 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.847e-45
Identity = 97/190 (51.05%), Postives = 126/190 (66.32%), Query Frame = -2
Query:  267 LIELGLGLEASKKPFIWVTRVGSKXXXXXXXXXXXXXXERI-KGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSSYNHIKLFIQDIMQQPSS 833
            L ELGLGLE++ +PFIWV R G K              ER  K     IRGW+PQV+ILSHPA+G F THCGWNS+LEGISAGV ++  PLFA+QF NEKL+V+VL IGV VGVE  + +G E+K G ++KKE V+ AI I+M            A+E GE+A+R +EEGGSSY  +++ IQ + ++  S
Sbjct:   50 LAELGLGLESTNQPFIWVIREGEKSEGLEKWILEEGYEERKRKREDFWIRGWSPQVLILSHPAIGAFFTHCGWNSTLEGISAGVPIVACPLFAEQFYNEKLVVEVLGIGVSVGVEAAVTWGLEDKCGAVMKKEQVKKAIEIVMDKGKEGEERRRRAREIGEMAKRTIEEGGSSYLDMEMLIQYVSERSPS 239          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: ANGT_GENTR (Anthocyanin 3'-O-beta-glucosyltransferase OS=Gentiana triflora PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.058e-32
Identity = 78/188 (41.49%), Postives = 107/188 (56.91%), Query Frame = -2
Query:  273 LIELGLGLEASKKPFIWVTRVG-SKXXXXXXXXXXXXXXERIKGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSSYNHIKLFIQDIMQQP 833
            L EL +GLE S + FIWV R    +               +    GL+I+GWAPQV+IL H AVG F++HCGWNS+LEGI  GV M+TWPLFA+QF NEKL+  +LR GV VG    +++       V+VK+E +  A+  LM            AK   E A++A+E GGSSY+ +   + ++   P
Sbjct:  297 LHELAMGLEESGQEFIWVVRTCVDEEDESKWFPDGFEKRVQENNKGLIIKGWAPQVLILEHEAVGAFVSHCGWNSTLEGICGGVAMVTWPLFAEQFYNEKLMTDILRTGVSVG---SLQWSRVTTSAVVVKRESISKAVRRLM-AEEEGVDIRNRAKALKEKAKKAVEGGGSSYSDLSALLVELSSYP 480          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: UFOG5_MANES (Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot esculenta GN=GT5 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 7.549e-23
Identity = 64/188 (34.04%), Postives = 97/188 (51.60%), Query Frame = -2
Query:  306 LIELGLGLEASKKPFIWVTR------------VGSKXXXXXXXXXXXXXXERIKGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSSYNHI 833
            +IEL  GLE S++ FIWV R                               RI+  GL++  W+PQ+ I+SHP+VG FL+HCGWNS LE I+AGV ++ WP++A+Q  N  L+ + L + V      P     +E    +VK+E++E  I  +M             +E  +  ++AL EGGSS+N++
Sbjct:  289 MIELAWGLERSQQRFIWVVRQPTVKTGDAAFFTQGDGADDMSGYFPEGFLTRIQNVGLVVPQWSPQIHIMSHPSVGVFLSHCGWNSVLESITAGVPIIAWPIYAEQRMNATLLTEELGVAVR-----PKNLPAKE----VVKREEIERMIRRIM-VDEEGSEIRKRVRELKDSGEKALNEGGSSFNYM 466          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: ZOX_PHAVU (Zeatin O-xylosyltransferase OS=Phaseolus vulgaris GN=ZOX1 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 9.860e-23
Identity = 69/186 (37.10%), Postives = 94/186 (50.54%), Query Frame = -2
Query:  285 ELGLGLEASKKPFIWVTRVGSKXXXXXXXXXXXXXXE-----RIKGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSSYNHIKLFIQDI 827
            EL  GLE SK+ FIWV R   K                    R++G GL++R WAPQ+ ILSH + GGF++HCGWNS LE ++ GV M TW + +DQ  N  L+  VL++G+ V      K  E+ K   LV    +E A+  LM             K   E+  R+++EGG S   +  FI  I
Sbjct:  276 ELATGLEQSKQKFIWVLRDADKGDIFDGSEAKRYELPEGFEERVEGMGLVVRDWAPQMEILSHSSTGGFMSHCGWNSCLESLTRGVPMATWAMHSDQPRNAVLVTDVLKVGLIV------KDWEQRK--SLVSASVIENAVRRLMETKEGDEIRKRAVKLKDEI-HRSMDEGGVSRMEMASFIAHI 452          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: ZOG_PHALU (Zeatin O-glucosyltransferase OS=Phaseolus lunatus GN=ZOG1 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 6.391e-22
Identity = 68/196 (34.69%), Postives = 96/196 (48.98%), Query Frame = -2
Query:  285 ELGLGLEASKKPFIWVTRVGSKXXXXXXXXXXXXXXE-----RIKGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRA----------LEEGGSSYNHIKLFIQDI 827
            ++  GLE SK+ FIWV R   K                    R++G GL++R WAPQ+ ILSH + GGF++HCGWNS LE I+ GV + TWP+ +DQ  N  L+ +VL++G+ V         +  +   LV    VE  +  LM             KE  E+ QRA          ++EGG S+  +  FI  I
Sbjct:  281 QIATGLEQSKQKFIWVLREADKGDIFAGSEAKRYELPKGFEERVEGMGLVVRDWAPQLEILSHSSTGGFMSHCGWNSCLESITMGVPIATWPMHSDQPRNAVLVTEVLKVGLVV--------KDWAQRNSLVSASVVENGVRRLM-----------ETKEGDEMRQRAVRLKNAIHRSMDEGGVSHMEMGSFIAHI 457          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: UFOG2_MANES (Anthocyanidin 3-O-glucosyltransferase 2 (Fragment) OS=Manihot esculenta GN=GT2 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 8.347e-22
Identity = 56/136 (41.18%), Postives = 84/136 (61.76%), Query Frame = -2
Query:  279 GWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSSYNHIKLFIQDIMQ 686
            GWAPQV +L+HPA+GGF++HCGWNS LE +  GV + TWP++A+Q  N   +V    + +G+GVE+ M + +E   G++V  + +E AI  LM             KE  E ++ AL +GGSS+  +  FI+D M+
Sbjct:  219 GWAPQVAVLAHPAIGGFVSHCGWNSVLESLWFGVPIATWPMYAEQQFNAFEMV----VELGLGVEIDMGYRKES--GIIVNSDKIERAIRKLM---ENSDEKRKKVKEMREKSKMALIDGGSSFISLGDFIKDAME 345          
BLAST of CF835708 vs. ExPASy Swiss-Prot
Match: ANGLT_ROSHC (Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hybrid cultivar GN=RhGT1 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.056e-20
Identity = 63/174 (36.21%), Postives = 87/174 (50.00%), Query Frame = -2
Query:  318 LGLGLEASKKPFIWVTRVGS-----KXXXXXXXXXXXXXXERIKGTGLLIRGWAPQVMILSHPAVGGFLTHCGWNSSLEGISAGVQMLTWPLFADQFCNEKLIVKVLRIGVGVGVEVPMKFGEEEKIGVLVKKEDVETAINILMXXXXXXXXXXXXAKEFGELAQRALEEGGSS 824
            + LGLE S + F+WV R                       ER K  GL++R WAPQV +LSH +VGGF+THCGWNS LE +  GV M+ WPL+A+Q      +V+ +++ VGV         +E + G  V  +++E  +  LM              EF     +A EEGGSS
Sbjct:  297 MALGLEKSGQRFLWVVRNPPIEELPVEEPSLEEILPKGFVERTKDRGLVVRKWAPQVEVLSHDSVGGFVTHCGWNSVLEAVCNGVPMVAWPLYAEQKLGRVFLVEEMKVAVGV---------KESETG-FVSADELEKRVRELM-DSESGDEIRGRVSEFSNGGVKAKEEGGSS 459          
The following BLAST results are available for this feature:
BLAST of CF835708 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
FOGT1_ARATH1.968e-5557.14Flavonol-3-O-glycoside-7-O-glucosyltransferase 1 O... [more]
COGT3_ARATH1.968e-5558.38Cytokinin-O-glucosyltransferase 3 OS=Arabidopsis t... [more]
COGT1_ARATH1.276e-5458.38Cytokinin-O-glucosyltransferase 1 OS=Arabidopsis t... [more]
UFOG4_MANES1.847e-4551.05Anthocyanidin 3-O-glucosyltransferase 4 (Fragment)... [more]
ANGT_GENTR3.058e-3241.49Anthocyanin 3'-O-beta-glucosyltransferase OS=Genti... [more]
UFOG5_MANES7.549e-2334.04Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot... [more]
ZOX_PHAVU9.860e-2337.10Zeatin O-xylosyltransferase OS=Phaseolus vulgaris ... [more]
ZOG_PHALU6.391e-2234.69Zeatin O-glucosyltransferase OS=Phaseolus lunatus ... [more]
UFOG2_MANES8.347e-2241.18Anthocyanidin 3-O-glucosyltransferase 2 (Fragment)... [more]
ANGLT_ROSHC2.056e-2036.21Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M01_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835708 ID=CF835708|Name=CF835708|organism=Citrus sinensis|type=EST|length=834bp
TTTTTTTTTTTTTTTGTGAACCCATTTTATTAATTGGAGAAACCAAATTG
CGTATGTACGCTCTTACATCAGCACTAGAGAAGAGCTAGAATTTCAACGG
CTCGGTAGAATGCCATCAGTCATCCTACGCGAAAAATGGGGTTCTCAAAT
CTCAAATCTCAAATCTCAACCCCATTAGTCTTTTCTGACTTCAAGAAAAT
TGCCATGGATACAGAAGCAAGCCAGCTTCACTTTGTTCTGTTTCCTTTCA
TGTCTTATATCACTTCTGAGGATGGCTGTTGCATGATATCTTGGATAAAC
AATTTGATATGGTTATAGGAAGATCCCCCTTCTTCTAAAGCTCTCTGTGC
CAACTCTCCAAACTCTTTGGCTCTTCTTCTTCTTGCATCTCTTTCTTCTC
CATCATCCATTAGTATGTTTATAGCCGTTTCGACATCTTCCTTCTTCACC
AACACTCCAATCTTCTCTTCTTCCCCAAACTTCATTGGAACTTCCACTCC
AACACCCACACCAATCCTTAAAACTTTCACAATCAACTTCTCGTTACAAA
ATTGGTCTGCAAAAAGTGGCCAGGTAAGCATTTGAACCCCGGCTGATATC
CCTTCCAGAGATGAATTCCAGCCACAATGTGTTAAGAATCCTCCTACTGC
AGGGTGTGACAATATCATTACTTGTGGAGCCCAACCTCGGATCAAAAGGC
CTGTCCCTTTAATCCTTTCTTCAAAATTTTCTTCTACAAGCCATTTCTCT
AGTTCTTCTAATTTACTTCCTACCCTTGTAACCCAAATAAATGGTTTCTT
AGATGCTTCCAGGCCTAAACCAAGCTCAATCAGT
back to top