CF835709

Overview
NameCF835709
Unique NameCF835709
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length753
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1124 contig Csv1_Contig1124:1..753. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: METB_ARATH (Cystathionine gamma-synthase, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=2 SV=3)

HSP 1 Score: 269.626 bits (688), Expect = 1.274e-71
Identity = 129/152 (84.87%), Postives = 140/152 (92.11%), Query Frame = -1
Query:  145 SLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI 600
            +LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA+ILEAHPKV  V+YPGL SHPEH +A +QMTGFGGVVSFE+DGD+  TIKF+D+LKIPYIAPSFGGCESIVDQPAIMSYWDL Q ERLKYGI DNLVRFSFGVEDFED+KAD+LQAL AI
Sbjct:  412 TLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: CGL_DICDI (Cystathionine gamma-lyase OS=Dictyostelium discoideum GN=cysA PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.522e-32
Identity = 65/147 (44.22%), Postives = 96/147 (65.31%), Query Frame = -1
Query:  154 NPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQAL 594
            +P   +L +RG+KTLH+R++     A  +   LE HPKV+RV YPGL SHP+H I  +QM G+GG+V F V G +  +  F++ +K+  +A S GG ES+++ P++M++  +   ER K GI D L+R S G+ED  DL AD+ QAL
Sbjct:  238 SPFDCFLALRGLKTLHVRMEAHQKNAFAICNFLEKHPKVERVIYPGLPSHPQHEICKRQMKGYGGMVVFFVKGSIDQSRSFLENIKLFALAESLGGVESLIELPSVMTHASVPAEERAKLGISDTLIRLSVGIEDINDLLADISQAL 384          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: METC_COXBU (Cystathionine beta-lyase OS=Coxiella burnetii GN=metC PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.868e-32
Identity = 65/146 (44.52%), Postives = 101/146 (69.18%), Query Frame = -1
Query:  154 PNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQAL 591
            P  +++++RG+KTL +R+++    A+++A+ LE HPKVKRV+YPGL SHP+H IA +QM  FGG++S E+  DL  T K ++  ++  +A S GG ES+++ PAIM++  + Q+ER K GI D  +R S G+E   DL+ D+  AL
Sbjct:  242 PFDSFMVLRGLKTLAIRMERHCENAMQLAQWLEKHPKVKRVYYPGLPSHPQHSIAKKQMRYFGGMISVELKCDLNETKKVLERCQLFTLAESLGGVESLIEHPAIMTHASIPQAERQKLGITDGFIRLSVGIEAITDLRHDLEAAL 387          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: METZ_PSEAE (O-succinylhomoserine sulfhydrylase OS=Pseudomonas aeruginosa GN=metZ PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 9.236e-30
Identity = 63/152 (41.45%), Postives = 103/152 (67.76%), Query Frame = -1
Query:  145 SLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI 600
            +L+P  A+L ++G++TL +R+Q  +++AL +A+ LE  P ++RV+Y GL SHP+H +A +Q +GFG VVSF+V G   A  +FIDA ++  I  + G  ++ +  PA  S+  LS  +R + GI D+L+R + G+ED +DLKAD+ + L A+
Sbjct:  252 TLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDSLIRVAVGLEDLDDLKADMARGLAAL 403          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: CGL2_CAEEL (Putative cystathionine gamma-lyase 2 OS=Caenorhabditis elegans GN=cth-2 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.987e-29
Identity = 62/147 (42.18%), Postives = 96/147 (65.31%), Query Frame = -1
Query:  154 NPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQAL 594
            +P   +L+ RG+KTLH+R++     AL +AK LEA+ +++ V YP L SHP+H +  +Q  G  G++SF + G+L  +  F+ ALK+  +A S GG ES+ + P+IM++  +    R+  GI DNL+R S G+ED +DL AD+ QAL
Sbjct:  239 SPFDCFLVNRGLKTLHIRMRAHYENALAVAKYLEANDRIESVLYPALPSHPQHEVHEKQTKGMSGMISFYLKGELQESRAFLSALKVFTLAESLGGYESLAELPSIMTHASVPAETRIVLGITDNLIRISVGIEDLDDLVADLDQAL 385          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: CGL_PIG (Cystathionine gamma-lyase OS=Sus scrofa GN=CTH PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.275e-28
Identity = 64/149 (42.95%), Postives = 97/149 (65.10%), Query Frame = -1
Query:  148 NPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHA 594
            +P   YL  RG+KTL +R+++     + +A+ LE+HP V++V YPGL SHP+H +A +Q TG  G++SF + G L     F+ +LK+  +A S GG ES+ + PAIM++  + +S+R   GI D L+R S G+ED +DL  D+ QAL A
Sbjct:  248 SPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESHPLVEKVIYPGLPSHPQHELAKRQCTGCPGMISFYIKGSLHHAETFLKSLKLFTLAESLGGYESLAELPAIMTHSSVPKSDREVLGIRDTLIRLSVGLEDKQDLMDDLDQALKA 396          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: METB_HELPY (Cystathionine gamma-synthase OS=Helicobacter pylori GN=metB PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.881e-28
Identity = 65/151 (43.05%), Postives = 98/151 (64.90%), Query Frame = -1
Query:  145 LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI 597
            L P  ++L+ RG+KTL LR++     AL +A+ LE HPKV+RV+YPGL +HP + +A +QM GF G++SF +  D  A + F+++LK+  +  S GG ES+V  PA M++  + +++R   GI D LVR S G+E  +DL  D+ QA   I
Sbjct:  230 LGPQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSGMLSFTLKNDSEA-VAFVESLKLFILGESLGGVESLVGIPAFMTHACIPKTQREAAGIRDGLVRLSVGIEHEQDLLEDLEQAFAKI 379          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: MEGL_PSEPU (Methionine gamma-lyase OS=Pseudomonas putida GN=mdeA PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 3.881e-28
Identity = 65/150 (43.33%), Postives = 100/150 (66.67%), Query Frame = -1
Query:  148 LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHA 597
            L+P+ A L++RG+KTL+LR+ +  + A  +A+ L   P+V+ +HYPGL S P++ +A QQM+  GG+++FE+ G + A  +F++AL++   A S G  ES+   PA M++   +  ER  YGI + LVR S G+ED +DL ADV QAL A
Sbjct:  247 LSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASFPQYTLARQQMSQPGGMIAFELKGGIGAGRRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLEDIDDLLADVQQALKA 396          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: METC_LACLM (Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metC PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 8.645e-28
Identity = 63/148 (42.57%), Postives = 96/148 (64.86%), Query Frame = -1
Query:  154 LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQAL 597
            L P  ++L+ RG+KTL LR++  ++ A ++A+ LE    V +V+YPGL SHP H IA +QM+ FGG++SFE+  D  A   F++ L    +A S GG ES+++ PA+M++  + +  R + GI D L+R S GVE  EDL  D+ +AL
Sbjct:  231 LGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSHPGHEIAKKQMSAFGGMISFELT-DENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELREEIGIKDGLIRLSVGVEAIEDLLTDIKEAL 377          
BLAST of CF835709 vs. ExPASy Swiss-Prot
Match: METC_LACLA (Cystathionine beta-lyase OS=Lactococcus lactis subsp. lactis GN=metC PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 8.645e-28
Identity = 63/148 (42.57%), Postives = 96/148 (64.86%), Query Frame = -1
Query:  154 LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQAL 597
            L P  ++L+ RG+KTL LR++  ++ A ++A+ LE    V +V+YPGL SHP H IA +QM+ FGG++SFE+  D  A   F++ L    +A S GG ES+++ PA+M++  + +  R + GI D L+R S GVE  EDL  D+ +AL
Sbjct:  231 LGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSHPGHEIAKKQMSAFGGMISFELT-DENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELREEIGIKDGLIRLSVGVEAIEDLLTDIKEAL 377          
The following BLAST results are available for this feature:
BLAST of CF835709 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
METB_ARATH1.274e-7184.87Cystathionine gamma-synthase, chloroplastic OS=Ara... [more]
CGL_DICDI1.522e-3244.22Cystathionine gamma-lyase OS=Dictyostelium discoid... [more]
METC_COXBU9.868e-3244.52Cystathionine beta-lyase OS=Coxiella burnetii GN=m... [more]
METZ_PSEAE9.236e-3041.45O-succinylhomoserine sulfhydrylase OS=Pseudomonas ... [more]
CGL2_CAEEL5.987e-2942.18Putative cystathionine gamma-lyase 2 OS=Caenorhabd... [more]
CGL_PIG2.275e-2842.95Cystathionine gamma-lyase OS=Sus scrofa GN=CTH PE=... [more]
METB_HELPY3.881e-2843.05Cystathionine gamma-synthase OS=Helicobacter pylor... [more]
MEGL_PSEPU3.881e-2843.33Methionine gamma-lyase OS=Pseudomonas putida GN=md... [more]
METC_LACLM8.645e-2842.57Cystathionine beta-lyase OS=Lactococcus lactis sub... [more]
METC_LACLA8.645e-2842.57Cystathionine beta-lyase OS=Lactococcus lactis sub... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M01_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835709 ID=CF835709|Name=CF835709|organism=Citrus sinensis|type=EST|length=753bp
ACGATATGAAGTTTTAAGATTATTCAAGGATTATTGTCACTAAAACATAA
TAACAAAACGAACATATTCAAACATCAAAAGAGAATGCCGTTAGGAAAAG
TAAAATGAAAAATTTGCGAAGGTGAAACACAAAAAACACTTCTATATGGC
GTGCAGGGCCTGAAGTACATCAGCCTTCAAATCTTCAAAATCTTCCACTC
CAAAGCTAAAGCGAACCAAGTTATCCATAATCCCATACTTGAGCCTCTCC
GATTGGCTAAGGTCCCAATACGACATTATAGCTGGCTGATCAACAATGCT
CTCACAGCCACCGAAGGATGGAGCAATATATGGGATTTTCAAGGCATCAA
TAAATTTTATGGTGGCCGTTAGGTCTCCATCAACCTCAAAACTAACTACC
CCACCAAAACCAGTCATTTGCTGTGTGGCAATGTGATGCTCAGGATGACT
CTTCAAGCCTGGATAGTGAACGCGCTTCACCTTTGGATGTGCCTCTAAAA
TCTTGGCCATCCTCAACGCAGTTGAATTTTGTTGCTGTACACGAAGATGC
AATGTCTTCATGCCTCGAATGATCAAATACGCGGCATTCGGGTTGAGAGA
ATATAGACATGCTTCCCTCGATAGACTTGGCCTCCAAGTTCTTCAATTCT
CTTAGCATGCTTCAATTGCCTTTTGAAAATTTGTTCAAAGAGCAAACTCC
TAAGCCCTGCTGCATAATCTCTGACATGGGCCATCCTTTGGACGTCGATA
CTG
back to top