CF835710

Overview
NameCF835710
Unique NameCF835710
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length751
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: PUB34_ARATH (U-box domain-containing protein 34 OS=Arabidopsis thaliana GN=PUB34 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 2.277e-57
Identity = 71/96 (73.96%), Postives = 82/96 (85.42%), Query Frame = 2
Query:   53 QVHRYDLP*KFPSNL-QVEVLSQIRHPHVVLLLGACPEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD 337
            +V R D P K    L +VEVLSQ+RHPHVVLLLGACPE  CLVYEYLENGSLE+YI+H+  KP LPWF+RF++IFEVACGLAFLH+SKP+PIVHRD
Sbjct:  469 KVVRLDTPEKKQEFLKEVEVLSQLRHPHVVLLLGACPENGCLVYEYLENGSLEEYIFHRKNKPPLPWFIRFRVIFEVACGLAFLHSSKPEPIVHRD 564          

HSP 2 Score: 93.9745 bits (232), Expect = 2.277e-57
Identity = 41/57 (71.93%), Postives = 51/57 (89.47%), Query Frame = 3
Query:  330 IETDNITEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVL 500
            +  DN+T YR ++LAGTLHY+DPEYHRTGTIRPKSDLYAFG+IILQLLT+  P+G++
Sbjct:  592 VAPDNVTMYRNSVLAGTLHYIDPEYHRTGTIRPKSDLYAFGIIILQLLTARNPSGIV 648          

HSP 3 Score: 110.923 bits (276), Expect = 7.518e-24
Identity = 54/92 (58.70%), Postives = 69/92 (75.00%), Query Frame = 2
Query:  503 DLDTEVMPVLRKLKDVADACVKLESSNVYAPSHFFCPI---------IAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAI 751
            DL +EV+PVL++L + A++ VK E SN+ APSH+FCPI         IAADGFTYE +AI AWLEKHN+SPVT+ +L H  + PN+TLRSAI
Sbjct:  696 DLKSEVIPVLKRLVETANSKVKKEGSNLRAPSHYFCPILREIMEEPEIAADGFTYERKAILAWLEKHNISPVTRQKLDHFKLTPNHTLRSAI 787          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: PUB35_ARATH (U-box domain-containing protein 35 OS=Arabidopsis thaliana GN=PUB35 PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 1.551e-39
Identity = 56/91 (61.54%), Postives = 70/91 (76.92%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGACPEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD*QHHRVQRDHS 370
            ++E+LS+IRHPH+VLLLGACPE   LVYEY+ENGSLED ++  N  P LPWF RF+I +EVA  L FLH SKPKPI+HRD +   +  DH+
Sbjct:  523 ELEILSKIRHPHLVLLLGACPEQGALVYEYMENGSLEDRLFQVNNSPPLPWFERFRIAWEVAAALVFLHKSKPKPIIHRDLKPANILLDHN 613          

HSP 2 Score: 59.3066 bits (142), Expect = 1.551e-39
Identity = 27/44 (61.36%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  348 TEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTS 479
            T Y++T   GTL Y+DPEY RTG I  KSD+Y+FG+I+LQLLT+
Sbjct:  637 TIYKQTSPVGTLCYIDPEYQRTGRISSKSDIYSFGMILLQLLTA 680          

HSP 3 Score: 73.9442 bits (180), Expect = 1.018e-12
Identity = 37/93 (39.78%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  503 DLDTEVMPVLRKLKDVAD-ACVKLESSNVYAPSHFFCPI---------IAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAI 751
            DL  +++P L  LK VA+ A       +   P+HF CP+         +AADG+TY+  AI+ WL++HN SP+T   L   +++PNYTL +AI
Sbjct:  736 DLKDQILPALENLKKVAEKARNSFSGVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRHAIEEWLKEHNTSPMTDSPLHSKNLLPNYTLYTAI 828          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: PUB52_ARATH (U-box domain-containing protein 52 OS=Arabidopsis thaliana GN=PUB52 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 6.292e-38
Identity = 53/91 (58.24%), Postives = 69/91 (75.82%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGACPEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD*QHHRVQRDHS 370
            ++E+LS+IRHPH+VLLLGACPE  CLVYEY++NGSL+D +   N  P +PWF RF+I  EVA  L FLH SKP+PI+HRD +   +  DH+
Sbjct:  533 ELEILSKIRHPHLVLLLGACPERGCLVYEYMDNGSLDDRLMLVNDTPPIPWFERFRIALEVASALVFLHKSKPRPIIHRDLKPGNILLDHN 623          

HSP 2 Score: 58.9214 bits (141), Expect = 6.292e-38
Identity = 26/44 (59.09%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  348 TEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTS 479
            T +++T   GTL Y+DPEY RTG I PKSD+Y+ GV+ILQL+T+
Sbjct:  646 TIFKQTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITA 689          

HSP 3 Score: 73.9442 bits (180), Expect = 1.018e-12
Identity = 40/93 (43.01%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  503 DLDTEVMPVLRKLKDVADACVKLESSNVYAP-SHFFCPI---------IAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAI 751
            DL  +++P L +L+ VAD    L S     P SHF CP+         +AADG+TY+  AI+ WL + + SPVT L L + ++I NYTL SAI
Sbjct:  745 DLKDQIIPALERLRKVADKAQNLLSRTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIEEWLRQKDTSPVTNLPLPNKNLIANYTLYSAI 837          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: PUB53_ARATH (Putative U-box domain-containing protein 53 OS=Arabidopsis thaliana GN=PUB53 PE=3 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 6.295e-38
Identity = 51/91 (56.04%), Postives = 68/91 (74.73%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGACPEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD*QHHRVQRDHS 370
            ++E+LS+IRHPH+VLLLGACP+   LVYEY+ENGSLED ++  N    +PWFVR +I +EVA  L FLH SKP PI+HRD +   +  +H+
Sbjct:  503 ELEILSKIRHPHLVLLLGACPDHGALVYEYMENGSLEDRLFQVNDSQPIPWFVRLRIAWEVASALVFLHKSKPTPIIHRDLKPANILLNHN 593          

HSP 2 Score: 63.929 bits (154), Expect = 6.295e-38
Identity = 30/43 (69.77%), Postives = 35/43 (81.40%), Query Frame = 3
Query:  348 TEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLT 476
            T Y++T   GTL Y+DPEY RTG I PKSD+YAFG+IILQLLT
Sbjct:  618 TMYKQTSPVGTLCYIDPEYQRTGRISPKSDVYAFGMIILQLLT 660          

HSP 3 Score: 86.6557 bits (213), Expect = 1.518e-16
Identity = 44/93 (47.31%), Postives = 62/93 (66.67%), Query Frame = 2
Query:  503 DLDTEVMPVLRKLKDVAD-ACVKLESSNVYAPSHFFCPI---------IAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAI 751
            DL+ +++PVL  LK VAD A   L ++    PSHFFCP+         IAADG+TY+ RAI+ W+E H  SPVT   LQ+++++PN+TL +AI
Sbjct:  719 DLEDQILPVLESLKKVADKARNSLSAAPSQPPSHFFCPLLKDVMKEPCIAADGYTYDRRAIEEWMENHRTSPVTNSPLQNVNLLPNHTLYAAI 811          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: PUB51_ARATH (U-box domain-containing protein 51 OS=Arabidopsis thaliana GN=PUB51 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 1.292e-31
Identity = 46/86 (53.49%), Postives = 62/86 (72.09%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGACPEINCLVYEYLENGSLEDYIYHQNGK------PALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD 337
            ++E+LS+IRHPH++LLLGACPE   LVYEY+ NGSLE+ +  +         P L WF RF+I +E+A  L FLH ++P+PIVHRD
Sbjct:  472 ELEILSKIRHPHLLLLLGACPERGSLVYEYMHNGSLEERLMKRRPNVDTPQPPPLRWFERFRIAWEIASALYFLHTNEPRPIVHRD 557          

HSP 2 Score: 59.3066 bits (142), Expect = 1.292e-31
Identity = 25/44 (56.82%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  348 TEYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTS 479
            T + ET   GT  Y+DPEY RTG + P+SD+YAFG+I+LQL+T+
Sbjct:  591 TVFNETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTA 634          

HSP 3 Score: 80.4925 bits (197), Expect = 1.088e-14
Identity = 42/97 (43.30%), Postives = 62/97 (63.92%), Query Frame = 2
Query:  503 DLDTEVMPVLRKLKDVADACVKLESSNVY-----APSHFFCPI---------IAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAI 751
            DL  E++PVL +LK+VA     + + N+      AP+HF+CPI         +A+DG+TYE RAIK WL+K++ SP+T L     S++PN++L SAI
Sbjct:  691 DLGKEILPVLERLKEVASIARNMFADNLIDHHHNAPTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKSPMTDLPFPSDSLLPNHSLLSAI 787          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: PUB33_ARATH (U-box domain-containing protein 33 OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 2.956e-23
Identity = 38/80 (47.50%), Postives = 54/80 (67.50%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGACPEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD 337
            +V+VLS++RHP+++ L+GACPE   LVYEYL  GSLED +  ++  P L W  R +I  E+   L FLH++K   +VH D
Sbjct:  524 EVDVLSKMRHPNIITLIGACPEGWSLVYEYLPGGSLEDRLTCKDNSPPLSWQNRVRIATEICAALVFLHSNKAHSLVHGD 603          

HSP 2 Score: 48.1358 bits (113), Expect = 2.956e-23
Identity = 20/38 (52.63%), Postives = 30/38 (78.95%), Query Frame = 3
Query:  363 TILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLT 476
            T + GT+ Y+DPE   +G + PKSD+Y+FG+I+L+LLT
Sbjct:  638 TDVTGTVAYLDPEASSSGELTPKSDVYSFGIILLRLLT 675          

HSP 3 Score: 69.3218 bits (168), Expect = 2.509e-11
Identity = 40/96 (41.67%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  503 DLDTEVMPVLRKLKDVADACVKLE---SSNVYAPSHFFCPI---------IAADGFTYEHRAIKAWLE-KHNVSPVTKLRLQHLSIIPNYTLRSAI 751
            DL TEV  VL  ++  +          + +  AP +F CPI         +AADGFTYE  AI+AWL+ +H+ SP+T ++L H S+I N+ LRSAI
Sbjct:  731 DLGTEVWRVLEPMRASSGGSSSFHLGRNEHRIAPPYFICPIFQEVMQDPHVAADGFTYEAEAIRAWLDSEHDTSPMTNVKLSHTSLIANHALRSAI 826          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: WAK1_ARATH (Wall-associated receptor kinase 1 OS=Arabidopsis thaliana GN=WAK1 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.116e-22
Identity = 39/82 (47.56%), Postives = 53/82 (64.63%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGAC--PEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD 337
            +V VLSQI H +VV LLG C   E+  LVYE++ NG+L D+++      +L W  R +I  EVA  LA+LH+S   PI+HRD
Sbjct:  453 EVLVLSQINHRNVVKLLGCCLETEVPLLVYEFITNGTLFDHLHGSMIDSSLTWEHRLKIAIEVAGTLAYLHSSASIPIIHRD 534          

HSP 2 Score: 54.6842 bits (130), Expect = 4.116e-22
Identity = 22/42 (52.38%), Postives = 34/42 (80.95%), Query Frame = 3
Query:  351 EYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLT 476
            E  ET++ GTL Y+DPEY+ TG +  KSD+Y+FGV++++LL+
Sbjct:  564 EELETMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLS 605          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: WAK3_ARATH (Wall-associated receptor kinase 3 OS=Arabidopsis thaliana GN=WAK3 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 3.376e-21
Identity = 38/82 (46.34%), Postives = 53/82 (64.63%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGAC--PEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD 337
            +V VLSQI H +VV +LG C   E+  LVYE++ NG+L D+++      +L W  R +I  EVA  LA+LH+S   PI+HRD
Sbjct:  459 EVLVLSQINHRNVVKILGCCLETEVPLLVYEFITNGTLFDHLHGSIFDSSLTWEHRLRIAIEVAGTLAYLHSSASIPIIHRD 540          

HSP 2 Score: 52.373 bits (124), Expect = 3.376e-21
Identity = 21/42 (50.00%), Postives = 33/42 (78.57%), Query Frame = 3
Query:  351 EYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLT 476
            E   T++ GTL Y+DPEY+ TG +  KSD+Y+FGV++++LL+
Sbjct:  570 EQLTTMVQGTLGYLDPEYYTTGLLNEKSDVYSFGVVLMELLS 611          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: WAK2_ARATH (Wall-associated receptor kinase 2 OS=Arabidopsis thaliana GN=WAK2 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.392e-21
Identity = 37/82 (45.12%), Postives = 53/82 (64.63%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGAC--PEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD 337
            +V VLSQI H +VV +LG C   E+  LVYE++ +G+L D+++      +L W  R +I  EVA  LA+LH+S   PI+HRD
Sbjct:  448 EVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRD 529          

HSP 2 Score: 53.9138 bits (128), Expect = 4.392e-21
Identity = 22/42 (52.38%), Postives = 33/42 (78.57%), Query Frame = 3
Query:  351 EYRETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLT 476
            E   TI+ GTL Y+DPEY+ TG +  KSD+Y+FGV++++LL+
Sbjct:  559 EQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLS 600          
BLAST of CF835710 vs. ExPASy Swiss-Prot
Match: WAKLI_ARATH (Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.634e-20
Identity = 34/82 (41.46%), Postives = 51/82 (62.20%), Query Frame = 2
Query:   98 QVEVLSQIRHPHVVLLLGAC--PEINCLVYEYLENGSLEDYIYHQNGKPALPWFVRFQIIFEVACGLAFLHNSKPKPIVHRD 337
            +V VLSQI H ++V L+G C   E+  LVYE++ NG L   ++H +    + W VR +I  E+A  LA+LH++   P+ HRD
Sbjct:  465 EVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRD 546          

HSP 2 Score: 50.8322 bits (120), Expect = 1.634e-20
Identity = 21/46 (45.65%), Postives = 33/46 (71.74%), Query Frame = 3
Query:  363 TILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVL 500
            T++AGT  Y+DPEY +T     KSD+Y+FGV++++L+T   P  V+
Sbjct:  580 TLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVM 625          
The following BLAST results are available for this feature:
BLAST of CF835710 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 199
Match NameE-valueIdentityDescription
PUB34_ARATH2.277e-5773.96U-box domain-containing protein 34 OS=Arabidopsis ... [more]
PUB35_ARATH1.551e-3961.54U-box domain-containing protein 35 OS=Arabidopsis ... [more]
PUB52_ARATH6.292e-3858.24U-box domain-containing protein 52 OS=Arabidopsis ... [more]
PUB53_ARATH6.295e-3856.04Putative U-box domain-containing protein 53 OS=Ara... [more]
PUB51_ARATH1.292e-3153.49U-box domain-containing protein 51 OS=Arabidopsis ... [more]
PUB33_ARATH2.956e-2347.50U-box domain-containing protein 33 OS=Arabidopsis ... [more]
WAK1_ARATH4.116e-2247.56Wall-associated receptor kinase 1 OS=Arabidopsis t... [more]
WAK3_ARATH3.376e-2146.34Wall-associated receptor kinase 3 OS=Arabidopsis t... [more]
WAK2_ARATH4.392e-2145.12Wall-associated receptor kinase 2 OS=Arabidopsis t... [more]
WAKLI_ARATH1.634e-2041.46Wall-associated receptor kinase-like 22 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M02_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835710 ID=CF835710|Name=CF835710|organism=Citrus sinensis|type=EST|length=751bp
TTTTTTTTTTTTTTTTTAAAAAAAAATGAGGTGCCTTATAATTTGTGAAT
CCCAAGTTCATAGATATGATCTGCCTTAAAAATTTCCTTCCAATTTGCAG
GTTGAAGTTTTAAGCCAGATACGACATCCACACGTGGTTCTGCTGCTTGG
AGCCTGTCCTGAGATCAATTGTTTGGTCTATGAATACCTGGAAAATGGAA
GCCTGGAGGACTATATTTACCATCAGAATGGGAAGCCTGCTCTTCCTTGG
TTTGTTCGGTTCCAGATAATTTTTGAAGTAGCCTGTGGACTTGCATTCTT
ACACAACTCAAAGCCAAAGCCTATTGTGCATCGAGACTGACAACATCACA
GAGTACAGAGAGACCATTCTTGCTGGTACTCTTCATTACATGGACCCAGA
ATATCACAGAACCGGCACTATTCGTCCCAAATCTGATCTATATGCATTTG
GAGTTATTATACTCCAGTTATTGACATCTTGCCTTCCGAATGGAGTTCTA
CTGATCTTGATACCGAAGTCATGCCGGTTCTCAGGAAACTCAAGGATGTT
GCAGATGCTTGTGTAAAGTTGGAAAGCAGCAATGTTTATGCACCAAGCCA
CTTCTTCTGTCCAATCATTGCTGCTGATGGATTTACTTATGAGCATAGAG
CAATCAAGGCATGGCTTGAGAAACACAATGTATCTCCAGTGACAAAGCTT
AGGCTCCAGCATTTGTCAATTATTCCAAACTACACACTGCGTTCTGCCAT
T
back to top