CF835714

Overview
NameCF835714
Unique NameCF835714
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length790
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF835714_ssr679 microsatellite CF835714_ssr679:679..688. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10229 contig Csv1_Contig10229:287..1015. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP_CUCSA (Oxygen-evolving enhancer protein 2, chloroplastic OS=Cucumis sativus GN=PSBP PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.277e-85
Identity = 155/182 (85.16%), Postives = 165/182 (90.66%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGKPK+NTD+LPY+GDGFKLSIPSKWNPSKEREFPGQVLRYEDNFD NSN+SVII PTDKKSI D+GSPEEFLSKVDYLLGKQAY GKT+SEGGFDPDAVATANILEA+        YYF+SVLTRTADGDEGGKHQLITATV  GKLYICKAQAGDKRWFKG RK+VE  ASSFSVA
Sbjct:   82 AANVFGKPKSNTDYLPYSGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVIINPTDKKSIKDFGSPEEFLSKVDYLLGKQAYFGKTASEGGFDPDAVATANILEATASNVNGKDYYFVSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVEGAASSFSVA 263          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP1_ARATH (Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Arabidopsis thaliana GN=PSBP1 PE=1 SV=2)

HSP 1 Score: 307.375 bits (786), Expect = 5.931e-83
Identity = 147/182 (80.77%), Postives = 167/182 (91.76%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGKPKTNTDFLPYNGDGFK+ +P+KWNPSKE E+PGQVLR+EDNFD  SN++V++TPTDKKSITDYGSPEEFLS+V+YLLGKQAY G+T+SEGGFD +AVATANILE+S +     PYY+LSVLTRTADGDEGGKHQLITATV GGKLYICKAQAGDKRWFKG RK+VES A+SFSVA
Sbjct:   82 AANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVESAATSFSVA 263          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP_SOLTU (Oxygen-evolving enhancer protein 2, chloroplastic OS=Solanum tuberosum GN=PSBP PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 3.254e-81
Identity = 147/182 (80.77%), Postives = 159/182 (87.36%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGKPK NTDFLPYNGDGFKL IP+KWNPSKE EFPGQVLRYEDNFD  SN+ V +TPTDKKSITDYGSPEEFLSKVDYLLGKQAY GKT SEGGF+  AVATAN+LEAS        YY+LSVLTRTADGDEGGKHQLITATV  GKLYICKAQAGDKRWFKG +K+VE+ A+SFS+A
Sbjct:   79 AANVFGKPKENTDFLPYNGDGFKLQIPAKWNPSKEIEFPGQVLRYEDNFDSTSNLMVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATANLLEASSATVGGKQYYYLSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVENAATSFSIA 260          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP_PEA (Oxygen-evolving enhancer protein 2, chloroplastic OS=Pisum sativum GN=PSBP PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 5.551e-81
Identity = 148/182 (81.32%), Postives = 160/182 (87.91%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGK KTNTD+LPYNGDGFKL +P+KWNPSKEREFPGQVLRYEDNFD  SNVSV++  TDKKSITDYGSPEEFLSKVDYLLGKQA+ G+T SEGGFD +AVA ANILE+S        YY +SVLTRTADGDEGGKHQLITATVK GKLYICKAQAGDKRWFKG RK+VE TASSFSVA
Sbjct:   78 AANVFGKAKTNTDYLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDTNAVAVANILESSAPVIGGKQYYNISVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVEDTASSFSVA 259          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP_SOLLC (Oxygen-evolving enhancer protein 2, chloroplastic OS=Solanum lycopersicum GN=PSBP PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 4.699e-80
Identity = 144/182 (79.12%), Postives = 158/182 (86.81%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGKPK NTDFLPYNGDGFKL +P+KWNPSKE E+PGQVLRYEDNFD  SN+ V +TPTDKKSITDYGSPEEFLSKVDYLLGKQAY GKT SEGGF+  AVAT N+LEAS        YY+LSVLTRTADGDEGGKHQLITATV  GKLYICKAQAGDKRWFKG +K+VE+ A+SFS+A
Sbjct:   77 AANVFGKPKENTDFLPYNGDGFKLQVPAKWNPSKEVEYPGQVLRYEDNFDSTSNLIVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATRNLLEASSATVGGKEYYYLSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVENAATSFSIA 258          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP_SINAL (Oxygen-evolving enhancer protein 2, chloroplastic OS=Sinapis alba GN=PSBP PE=2 SV=2)

HSP 1 Score: 293.893 bits (751), Expect = 6.786e-79
Identity = 139/182 (76.37%), Postives = 162/182 (89.01%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGKPK NTDF  Y+GDGF++ +P+KWNPS+E E+PGQVLRYEDNFD  SN++V++TPTDKKSITDYGSPEEFLS+V+YLLGKQAY G+T+SEGGFD +AVATANILE +++     PYY+LSVLTRTADGDEGGKHQLITATV GGKLYICKAQAGDKRWFKG  K+VE  A+SFSVA
Sbjct:   79 AANVFGKPKKNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNIQDVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVEKAATSFSVA 260          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP_FRIAG (Oxygen-evolving enhancer protein 2, chloroplastic OS=Fritillaria agrestis GN=PSBP PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 6.786e-79
Identity = 144/182 (79.12%), Postives = 157/182 (86.26%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGK KTNTDFLPY GDGF L IP+KWNPSKE EFPGQVLRYEDNFD  SNVSV +TPT KKSITDYG+PEEFLS VDYLLGKQAYSGKT+SEGGFDPD+VATANILE S        YY +SVLTRTADGDEGGKH +I+ATV  GKLYICKAQAGDKRWFKG +K+VEST +SF+VA
Sbjct:   83 AANVFGKAKTNTDFLPYTGDGFNLLIPAKWNPSKEVEFPGQVLRYEDNFDVTSNVSVTVTPTSKKSITDYGTPEEFLSTVDYLLGKQAYSGKTASEGGFDPDSVATANILEVSTPVVGGKQYYNISVLTRTADGDEGGKHHVISATVTDGKLYICKAQAGDKRWFKGAKKFVESTTTSFNVA 264          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP2_TOBAC (Oxygen-evolving enhancer protein 2-2, chloroplastic OS=Nicotiana tabacum GN=PSBP2 PE=1 SV=2)

HSP 1 Score: 293.508 bits (750), Expect = 8.863e-79
Identity = 142/182 (78.02%), Postives = 160/182 (87.91%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGKPKT+TDF  YNGDGFKL IPSKWNP+KE E+PGQVLR+EDNFD  SNV V ITPTDKKSITD+GSPE+FLS+VDYLLG+QAYSGKT SEGGF+ DAVA AN+LE S       PYY+LSVLTRTADG+EGGKHQLITATV  GKLYICKAQAGDKRWFKG +K+VE+TA+SFS+A
Sbjct:   84 AANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSSAEVGGKPYYYLSVLTRTADGNEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVENTATSFSLA 265          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP1_TOBAC (Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Nicotiana tabacum GN=PSBP1 PE=3 SV=2)

HSP 1 Score: 293.508 bits (750), Expect = 8.863e-79
Identity = 143/182 (78.57%), Postives = 157/182 (86.26%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGKPK NTDFL YNGDGFKL +P+KWNPSKE EFPGQVLRYEDNFD  SN+ V +TPTDKKSITDYGSPEEFL++VD+LLGKQAY GKT SEGGF+  AVATAN+LE S        YY LSVLTRTADGDEGGKHQLI+ATV GGKLYICKAQAGDKRWFKG RK+VE+ A+SFSVA
Sbjct:   87 AANVFGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGKTDSEGGFESGAVATANLLETSSSTVGGKEYYILSVLTRTADGDEGGKHQLISATVNGGKLYICKAQAGDKRWFKGARKFVENAATSFSVA 268          
BLAST of CF835714 vs. ExPASy Swiss-Prot
Match: PSBP_SPIOL (Oxygen-evolving enhancer protein 2, chloroplastic OS=Spinacia oleracea GN=PSBP PE=1 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.579e-78
Identity = 139/182 (76.37%), Postives = 158/182 (86.81%), Query Frame = -2
Query:  256 SANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVESTASSFSVA 789
            +ANVFGKPK NT+F+PYNGDGFKL +PSKWNPSKE+EFPGQVLRYEDNFD  SN+SV++ PTDKKSITD+GSPE+FLS+VDYLLGKQAY GKT SEGGFD   VA+AN+LE+S        YY ++VLTRTADGDEGGKHQ+I ATVK GKLYICKAQAGDKRWFKG +K+VES  SSFSVA
Sbjct:   86 AANVFGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLSVLVQPTDKKSITDFGSPEDFLSQVDYLLGKQAYFGKTDSEGGFDSGVVASANVLESSTPVVDGKQYYSITVLTRTADGDEGGKHQVIAATVKDGKLYICKAQAGDKRWFKGAKKFVESATSSFSVA 267          
The following BLAST results are available for this feature:
BLAST of CF835714 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
PSBP_CUCSA1.277e-8585.16Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP1_ARATH5.931e-8380.77Oxygen-evolving enhancer protein 2-1, chloroplasti... [more]
PSBP_SOLTU3.254e-8180.77Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_PEA5.551e-8181.32Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_SOLLC4.699e-8079.12Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_SINAL6.786e-7976.37Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_FRIAG6.786e-7979.12Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP2_TOBAC8.863e-7978.02Oxygen-evolving enhancer protein 2-2, chloroplasti... [more]
PSBP1_TOBAC8.863e-7978.57Oxygen-evolving enhancer protein 2-1, chloroplasti... [more]
PSBP_SPIOL2.579e-7876.37Oxygen-evolving enhancer protein 2, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M04_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835714 ID=CF835714|Name=CF835714|organism=Citrus sinensis|type=EST|length=790bp
TTTTTTTTTTTTTTGTGGCTGGAACTGCAGGGGACAATTTACTCTTTAAC
ACACAGAATGTGACGGGAAACATTTGTAACAGCTATACAAGAGGGTCCTT
ATATGCCATTAAATACTCAAATATCCACAAGCTTTTTCCAACCAACTCCT
TCAATTAGAAACTCAGAAGCTTTTGGGGAAAGATGGGAGTAGATAATTCA
AAACAAACAGCATACATTAAGTTGGATTTACATAAAAATTCTGATTAATG
TCTCAAGCAACACTGAAAGAACTGGCAGTGCTTTCCACATACTTTCTTGT
TCCCTTAAACCACCTCTTGTCTCCAGCTTGCGCCTTGCAGATGTAAAGCT
TGCCACCTTTAACCGTGGCTGTAATTAGTTGATGCTTGCCACCTTCATCT
CCATCAGCAGTTCTTGTTAATACAGACAAGAAGTAGTATGGTGGTCGGAC
TGAAGCCTCCAAGATGTTAGCTGTTGCCACAGCATCAGGGTCGAAACCAC
CCTCAGACGAAGTTTTGCCGGAATAGGCTTGTTTTCCCAGCAAGTAGTCC
ACCTTACTGAGGAATTCCTCGGGGGAACCGTAGTCAGTGATGGATTTCTT
GTCAGTTGGGGTGATTATGACGGAGACATTGCTGTTGGGATCAAAGTTGT
CTTCGTATCTAAGAACCTGACCAGGGAACTCTCTCTCTTTGCTGGGGTTC
CATTTTGAGGGAATCGACAGCTTGAATCCATCTCCATTGTATGGCAAGAA
GTCAGTGTTGGTCTTTGGCTTACCAAACACATTGGCAGAT
back to top