CF835715

Overview
NameCF835715
Unique NameCF835715
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length690
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF835715_ssr362 microsatellite CF835715_ssr362:362..371. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10229 contig Csv1_Contig10229:28..717. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP_CUCSA (Oxygen-evolving enhancer protein 2, chloroplastic OS=Cucumis sativus GN=PSBP PE=2 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 1.149e-97
Identity = 185/229 (80.79%), Postives = 200/229 (87.34%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRHVSNIK-PTQIVCRAQKQA-VQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATV 689
            MAST CFLHHHAL T  AR+SSS R  +  K P  +VCRAQKQ   QE++G  VSRRLALTVLIGAAA+GSKVSPADAAYGE+ANVFGKPK+NTD+LPY+GDGFKLSIPSKWNPSKEREFPGQVLRYEDNFD NSN+SVII PTDKKSI D+GSPEEFLSKVDYLLGKQAY GKT+SEGGFDPDAVATANILEA+        YYF+SVLTRTADGDEGGKHQLITATV
Sbjct:    1 MASTSCFLHHHAL-TAAARSSSSPRQAALPKSPQLLVCRAQKQQPAQEEEGGVVSRRLALTVLIGAAALGSKVSPADAAYGEAANVFGKPKSNTDYLPYSGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVIINPTDKKSIKDFGSPEEFLSKVDYLLGKQAYFGKTASEGGFDPDAVATANILEATASNVNGKDYYFVSVLTRTADGDEGGKHQLITATV 228          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP1_TOBAC (Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Nicotiana tabacum GN=PSBP1 PE=3 SV=2)

HSP 1 Score: 346.665 bits (888), Expect = 6.973e-95
Identity = 179/233 (76.82%), Postives = 201/233 (86.27%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSS---QRHVSNIKPTQIVCRAQKQAV-QEDDGSAV--SRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATV 689
            MASTQCFLH HALS++ ART+SS   QR+VS++KP Q+VCRAQKQ+  QEDDG++V  SRRLALTVLIGAAA+GSKVSPADAAYGE+ANVFGKPK NTDFL YNGDGFKL +P+KWNPSKE EFPGQVLRYEDNFD  SN+ V +TPTDKKSITDYGSPEEFL++VD+LLGKQAY GKT SEGGF+  AVATAN+LE S        YY LSVLTRTADGDEGGKHQLI+ATV
Sbjct:    1 MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSRRLALTVLIGAAAIGSKVSPADAAYGEAANVFGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGKTDSEGGFESGAVATANLLETSSSTVGGKEYYILSVLTRTADGDEGGKHQLISATV 233          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP1_ARATH (Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Arabidopsis thaliana GN=PSBP1 PE=1 SV=2)

HSP 1 Score: 345.125 bits (884), Expect = 2.029e-94
Identity = 174/230 (75.65%), Postives = 202/230 (87.83%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSS---QRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATV 689
            MA + CFLH  AL+++ AR+SSS   QRHVS  KP QI+C+AQ+    EDD SAVSRRLALT+L+GAAAVGSKVSPADAAYGE+ANVFGKPKTNTDFLPYNGDGFK+ +P+KWNPSKE E+PGQVLR+EDNFD  SN++V++TPTDKKSITDYGSPEEFLS+V+YLLGKQAY G+T+SEGGFD +AVATANILE+S +     PYY+LSVLTRTADGDEGGKHQLITATV
Sbjct:    1 MAYSACFLHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQS--HEDDNSAVSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATV 228          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP_SOLTU (Oxygen-evolving enhancer protein 2, chloroplastic OS=Solanum tuberosum GN=PSBP PE=2 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 6.526e-93
Identity = 175/227 (77.09%), Postives = 192/227 (84.58%), Query Frame = 3
Query:   24 ASTQCFLH-HHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATV 689
            ASTQCFLH +HAL ++PARTSS    V + KP Q++CRAQKQ    +  +AVSRRLALT+LIG AA+GSKVSPADAAYGE+ANVFGKPK NTDFLPYNGDGFKL IP+KWNPSKE EFPGQVLRYEDNFD  SN+ V +TPTDKKSITDYGSPEEFLSKVDYLLGKQAY GKT SEGGF+  AVATAN+LEAS        YY+LSVLTRTADGDEGGKHQLITATV
Sbjct:    3 ASTQCFLHQYHALRSSPARTSS----VPSPKPNQLICRAQKQDDANNTSNAVSRRLALTLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQIPAKWNPSKEIEFPGQVLRYEDNFDSTSNLMVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATANLLEASSATVGGKQYYYLSVLTRTADGDEGGKHQLITATV 225          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP2_TOBAC (Oxygen-evolving enhancer protein 2-2, chloroplastic OS=Nicotiana tabacum GN=PSBP2 PE=1 SV=2)

HSP 1 Score: 337.035 bits (863), Expect = 5.525e-92
Identity = 175/231 (75.76%), Postives = 196/231 (84.85%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQI-VCRAQKQAVQEDDGS---AVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATV 689
            MASTQCFLHHHALST PART   +  V ++KP Q+ VCRAQKQ+  ++D     +VSRRLALTVLIGAAAVGSKVSPADAAYGE+ANVFGKPKT+TDF  YNGDGFKL IPSKWNP+KE E+PGQVLR+EDNFD  SNV V ITPTDKKSITD+GSPE+FLS+VDYLLG+QAYSGKT SEGGF+ DAVA AN+LE S       PYY+LSVLTRTADG+EGGKHQLITATV
Sbjct:    1 MASTQCFLHHHALST-PARTPLVRSIVPSLKPNQLLVCRAQKQSAPQEDNVNSVSVSRRLALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSSAEVGGKPYYYLSVLTRTADGNEGGKHQLITATV 230          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP_SOLLC (Oxygen-evolving enhancer protein 2, chloroplastic OS=Solanum lycopersicum GN=PSBP PE=2 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.607e-91
Identity = 176/229 (76.86%), Postives = 193/229 (84.28%), Query Frame = 3
Query:   24 ASTQCFLH-HHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGS--AVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATV 689
            ASTQCFLH +HAL ++PARTSS    VS+ KP Q++CRAQKQ    DD S  AVSRRLALT+LIG AA+GSKVSPADAAYGE+ANVFGKPK NTDFLPYNGDGFKL +P+KWNPSKE E+PGQVLRYEDNFD  SN+ V +TPTDKKSITDYGSPEEFLSKVDYLLGKQAY GKT SEGGF+  AVAT N+LEAS        YY+LSVLTRTADGDEGGKHQLITATV
Sbjct:    3 ASTQCFLHQYHALRSSPARTSS----VSSPKPNQLICRAQKQ----DDASNAAVSRRLALTLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQVPAKWNPSKEVEYPGQVLRYEDNFDSTSNLIVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATRNLLEASSATVGGKEYYYLSVLTRTADGDEGGKHQLITATV 223          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP_PEA (Oxygen-evolving enhancer protein 2, chloroplastic OS=Pisum sativum GN=PSBP PE=1 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.042e-90
Identity = 174/227 (76.65%), Postives = 188/227 (82.82%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYFLSVLTRTADGDEGGKHQLITATV 689
            MASTQCFLHH    TTP RT S QR V   KP  IVC+AQKQ    D  + VSRRLAL+VLIGAAAVGSKVSPADAAYGE+ANVFGK KTNTD+LPYNGDGFKL +P+KWNPSKEREFPGQVLRYEDNFD  SNVSV++  TDKKSITDYGSPEEFLSKVDYLLGKQA+ G+T SEGGFD +AVA ANILE+S        YY +SVLTRTADGDEGGKHQLITATV
Sbjct:    1 MASTQCFLHHQYAITTPTRTLS-QRQVVTTKPNHIVCKAQKQDDVVD--AVVSRRLALSVLIGAAAVGSKVSPADAAYGEAANVFGKAKTNTDYLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDTNAVAVANILESSAPVIGGKQYYNISVLTRTADGDEGGKHQLITATV 224          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP_SPIOL (Oxygen-evolving enhancer protein 2, chloroplastic OS=Spinacia oleracea GN=PSBP PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 8.820e-90
Identity = 169/232 (72.84%), Postives = 195/232 (84.05%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPA--RTSSSQRHVS-NIKPTQIVCRAQKQAVQEDD--GSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYFLSVLTRTADGDEGGKHQLITATV 689
            MAST CFLHHHA  ++PA  R S++QR+ + +IKP QIVC+AQKQ   E +   S VSRRLALTVLIGAAAVGSKVSPADAAYGE+ANVFGKPK NT+F+PYNGDGFKL +PSKWNPSKE+EFPGQVLRYEDNFD  SN+SV++ PTDKKSITD+GSPE+FLS+VDYLLGKQAY GKT SEGGFD   VA+AN+LE+S        YY ++VLTRTADGDEGGKHQ+I ATV
Sbjct:    1 MASTACFLHHHAAISSPAAGRGSAAQRYQAVSIKPNQIVCKAQKQDDNEANVLNSGVSRRLALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLSVLVQPTDKKSITDFGSPEDFLSQVDYLLGKQAYFGKTDSEGGFDSGVVASANVLESSTPVVDGKQYYSITVLTRTADGDEGGKHQVIAATV 232          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP_FRIAG (Oxygen-evolving enhancer protein 2, chloroplastic OS=Fritillaria agrestis GN=PSBP PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.274e-88
Identity = 168/230 (73.04%), Postives = 191/230 (83.04%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRH--VSNIKPTQIVCRAQKQA-VQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYFLSVLTRTADGDEGGKHQLITATV 689
            MAS+ CFL HHA ST PA TS +  H  V  IKP+Q++CRAQK +   E+  +AVSRRLALT+LIG+AAVG+K++PA+AAYGE+ANVFGK KTNTDFLPY GDGF L IP+KWNPSKE EFPGQVLRYEDNFD  SNVSV +TPT KKSITDYG+PEEFLS VDYLLGKQAYSGKT+SEGGFDPD+VATANILE S        YY +SVLTRTADGDEGGKH +I+ATV
Sbjct:    1 MASSACFLLHHAPST-PATTSRTPSHRLVPTIKPSQLICRAQKSSDTDENSSTAVSRRLALTILIGSAAVGTKIAPANAAYGEAANVFGKAKTNTDFLPYTGDGFNLLIPAKWNPSKEVEFPGQVLRYEDNFDVTSNVSVTVTPTSKKSITDYGTPEEFLSTVDYLLGKQAYSGKTASEGGFDPDSVATANILEVSTPVVGGKQYYNISVLTRTADGDEGGKHHVISATV 229          
BLAST of CF835715 vs. ExPASy Swiss-Prot
Match: PSBP3_TOBAC (Oxygen-evolving enhancer protein 2-3, chloroplastic OS=Nicotiana tabacum GN=PSBP3 PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.274e-88
Identity = 171/232 (73.71%), Postives = 194/232 (83.62%), Query Frame = 3
Query:   21 MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQI-VCRAQ-KQAVQEDDGS---AVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATV 689
            MASTQCFLHHHALST PARTS  +  V ++K  Q+ VCRAQ KQ+  + D     +VSRRLALT+LIGAAAVGSKVSPADAAYGE+ANVFGKPKT+TDF  YNGDGFKL IPSKWNP+KE E+PGQVLR+EDNFD  SNV V ITPTDKKSITD+GSPE+FLS+VDYLLG+QAYSGKT SEGGF+ DAVA AN+LE S        YY+LS+LTRTADG+EGGKHQL+TATV
Sbjct:    1 MASTQCFLHHHALST-PARTSLVRGIVPSLKSNQLLVCRAQNKQSAPQQDNVNSVSVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSTAEVGGKQYYYLSILTRTADGNEGGKHQLVTATV 231          
The following BLAST results are available for this feature:
BLAST of CF835715 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
PSBP_CUCSA1.149e-9780.79Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP1_TOBAC6.973e-9576.82Oxygen-evolving enhancer protein 2-1, chloroplasti... [more]
PSBP1_ARATH2.029e-9475.65Oxygen-evolving enhancer protein 2-1, chloroplasti... [more]
PSBP_SOLTU6.526e-9377.09Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP2_TOBAC5.525e-9275.76Oxygen-evolving enhancer protein 2-2, chloroplasti... [more]
PSBP_SOLLC1.607e-9176.86Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_PEA1.042e-9076.65Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_SPIOL8.820e-9072.84Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_FRIAG1.274e-8873.04Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP3_TOBAC1.274e-8873.71Oxygen-evolving enhancer protein 2-3, chloroplasti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M04_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835715 ID=CF835715|Name=CF835715|organism=Citrus sinensis|type=EST|length=690bp
GAAGAGAGCGAAAAGAAAAAATGGCTTCAACTCAATGCTTCTTGCACCAC
CATGCACTCTCTACTACACCAGCAAGAACATCATCATCTCAGCGCCACGT
GTCAAACATCAAGCCCACCCAGATTGTCTGCCGTGCGCAGAAGCAAGCTG
TCCAAGAAGATGACGGCAGCGCCGTCTCCCGCCGTTTGGCTCTGACGGTG
CTCATTGGTGCTGCTGCCGTCGGCTCCAAGGTCTCTCCTGCCGACGCTGC
CTACGGTGAATCTGCCAATGTGTTTGGTAAGCCAAAGACCAACACTGACT
TCTTGCCATACAATGGAGATGGATTCAAGCTGTCGATTCCCTCAAAATGG
AACCCCAGCAAAGAGAGAGAGTTCCCTGGTCAGGTTCTTAGATACGAAGA
CAACTTTGATCCCAACAGCAATGTCTCCGTCATAATCACCCCAACTGACA
AGAAATCCATCACTGACTACGGTTCCCCCGAGGAATTCCTCAGTAAGGTG
GACTACTTGCTGGGAAAACAAGCCTATTCCGGCAAAACTTCGTCTGAGGG
TGGTTTCGACCCTGATGCTGTGGCAACAGCTAACATCTTGGAGGCTTCAG
TCCGACCACCATACTACTTCTTGTCTGTATTAACAAGAACTGCTGATGGA
GATGAAGGTGGCAAGCATCAACTAATTACAGCCACGGTTA
back to top