CF835719

Overview
NameCF835719
Unique NameCF835719
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length767
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13467 contig Csv1_Contig13467:234..1000. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: RUBB_ARATH (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Arabidopsis thaliana GN=At1g55490 PE=1 SV=3)

HSP 1 Score: 266.159 bits (679), Expect = 1.450e-70
Identity = 137/158 (86.71%), Postives = 142/158 (89.87%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSGYGY 476
            KEKKLRVEDALNATKAA          CTLLRL+SKVDAIK TLDNDEEKVGADIVKRAL YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA+SVAKTFLMSDCVVVEIKEPEP +P GNPMDNSGYGY
Sbjct:  444 KEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEP-VPVGNPMDNSGYGY 600          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: RUBB_PEA (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 263.848 bits (673), Expect = 7.195e-70
Identity = 138/157 (87.90%), Postives = 140/157 (89.17%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSGYG 473
            KEKKLRVEDALNATKAA          CTLLRL+SKVDAIK+TL NDEEKVGADIVKRAL YPLKLIAKNAGVNGSVVSEKVLSSDN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPE A P GNPMDNSGYG
Sbjct:  438 KEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLANDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPESA-PVGNPMDNSGYG 593          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: RUBB_SECCE (RuBisCO large subunit-binding protein subunit beta, chloroplastic (Fragment) OS=Secale cereale GN=CPN60 PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.829e-66
Identity = 128/158 (81.01%), Postives = 140/158 (88.61%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSGYGY 476
            KEKKLRVEDALNATKAA          CTLLRL++KVDAIK+TL+NDE+KVGA+IV+RALCYPLKLIAKNAGVNGSVV+EKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA+SVAKTFL SD VVVEIKEPE A P  NPMDNSG+GY
Sbjct:  343 KEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALCYPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSDVVVVEIKEPE-AAPLANPMDNSGFGY 499          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: RUBB_BRANA (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 8.518e-63
Identity = 124/143 (86.71%), Postives = 128/143 (89.51%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEP 431
            KEKKLRVEDALNATKAA          CTLLRL+SKVDAIK  LDNDEEKVGADIVKRAL YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA+SVAKTFLMSDCVVVEIKEPEP
Sbjct:  444 KEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEP 586          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: RUBC_CHLRE (RuBisCO large subunit-binding protein subunit beta-2 (Fragment) OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.011e-47
Identity = 103/151 (68.21%), Postives = 117/151 (77.48%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSS-DNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEI--KEPEPAMPAG 446
            KEKKLRVEDALNATKAA          CTLLRLS KVD+IKETL N+E+K+GADI+KRAL YP+KLIA NAG NGSVV ++V+ + D   YGYNAAT  +EDLM AGIIDPTKVVRC LE+A SVAKTFL++D VV EI  KE  PA  AG
Sbjct:  105 KEKKLRVEDALNATKAAVEEGIVIGGGCTLLRLSQKVDSIKETLSNEEQKMGADIIKRALSYPIKLIANNAGTNGSVVMQRVMDNIDQPYYGYNAATDTFEDLMEAGIIDPTKVVRCSLENAVSVAKTFLLADVVVTEIPEKEKAPAPAAG 255          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: RUBB_CHLRE (RuBisCO large subunit-binding protein subunit beta-1 (Fragment) OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.192e-44
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSS-DNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSGYGY 476
            KEKKLRVEDALNAT+AA          CTLLRLS KVD IK  + + E+++GADI+KRALCYP+KLIA+NAGVNGSVV  +V+ + D   YGYNAAT ++E+LM  GIIDP+KVVRC +E+A SVAKTFL++D VV E+KE E A    NP+     G+
Sbjct:  274 KEKKLRVEDALNATRAAVEEGVVPGGGCTLLRLSEKVDVIKRRMTDPEQQMGADIIKRALCYPIKLIAQNAGVNGSVVMNEVMKNLDRPHYGYNAATDSFENLMETGIIDPSKVVRCSMENAVSVAKTFLLADVVVTELKEIE-AGAKPNPVAPGAAGF 431          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: CH602_ANAVT (60 kDa chaperonin 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=groL2 PE=3 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 5.754e-35
Identity = 85/155 (54.84%), Postives = 107/155 (69.03%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSG 467
            K++KLR+EDALNATKAA           TL+ L+SKVD IK+  D +EEK+GADIVKRAL  PL+ IA NAGV GSV+  +V  SD +  GYNAATG +EDL+AAGIIDP KVVR  L++A+S+A   L ++ +VVE  E + A PA   M   G
Sbjct:  388 KDRKLRIEDALNATKAAVAEGIVPGGGKTLIYLASKVDEIKKNFD-EEEKIGADIVKRALEAPLRQIADNAGVEGSVIVSRVKDSDFNT-GYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGLVLTTEAIVVEKPEKKAAAPADAGMGGMG 540          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: CH602_ANASP (60 kDa chaperonin 2 OS=Anabaena sp. (strain PCC 7120) GN=groL2 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.282e-34
Identity = 84/155 (54.19%), Postives = 105/155 (67.74%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSG 467
            K++KLR+EDALNATKAA           TL+ L+SKVD IK+  D +EEK+GADIVKRAL  PL+ IA NAG  GSV+  +V  SD    GYNAATG +EDL+AAGIIDP KVVR  L++A+S+A   L ++ +VVE  E + A PA   M   G
Sbjct:  388 KDRKLRIEDALNATKAAVAEGIVPGGGKTLIYLASKVDEIKKNFD-EEEKIGADIVKRALEAPLRQIADNAGAEGSVIVSRVKDSD-FNIGYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGLVLTTEAIVVEKPEKKSAAPADAGMGGMG 540          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: CH601_TRIEI (60 kDa chaperonin 1 OS=Trichodesmium erythraeum (strain IMS101) GN=groL1 PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.856e-34
Identity = 79/146 (54.11%), Postives = 102/146 (69.86%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEPAMP 440
            K++KLR+EDALNATKAA           TL+ LS+KV+ +K +L+N+EEK+GADIV+RAL  PL  IA N+GV GSV+ EKV S+D    GYN  TG YEDL+AAGI+DP  VVR  L++A S+A   L ++ VVVE  E + A P
Sbjct:  388 KDRKLRIEDALNATKAAVEEGIVPGGGTTLIHLSTKVEELKGSLNNEEEKIGADIVRRALEAPLNQIANNSGVEGSVIVEKVRSTD-FSVGYNVITGEYEDLIAAGILDPAMVVRSALQNAGSIAGMVLTTEAVVVEKPEKKGAAP 532          
BLAST of CF835719 vs. ExPASy Swiss-Prot
Match: CH602_SYNP6 (60 kDa chaperonin 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=groL2 PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.871e-34
Identity = 79/155 (50.97%), Postives = 103/155 (66.45%), Query Frame = 3
Query:    3 KEKKLRVEDALNATKAAXXXXXXXXXXCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSG 467
            K +KLR+EDALNAT+AA           TLL L+S + +++ +L   +EK+G +IV RAL  PL+ IA NAG  GSVV EK+   D   +GYNA TG YEDL+A+GI+DP KVVR  L+ A+SVA   L ++ +VV+  EPEPAMPAG  M   G
Sbjct:  389 KNRKLRIEDALNATRAAIEEGVVPGGGTTLLHLASALTSLQASLTVADEKLGVEIVARALEAPLRQIADNAGAEGSVVVEKLRDKD-FNFGYNALTGQYEDLVASGILDPAKVVRSALQDAASVASLILTTEVLVVDQPEPEPAMPAGGDMGGMG 542          
The following BLAST results are available for this feature:
BLAST of CF835719 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RUBB_ARATH1.450e-7086.71RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_PEA7.195e-7087.90RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_SECCE2.829e-6681.01RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_BRANA8.518e-6386.71RuBisCO large subunit-binding protein subunit beta... [more]
RUBC_CHLRE1.011e-4768.21RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_CHLRE5.192e-4459.75RuBisCO large subunit-binding protein subunit beta... [more]
CH602_ANAVT5.754e-3554.8460 kDa chaperonin 2 OS=Anabaena variabilis (strain... [more]
CH602_ANASP1.282e-3454.1960 kDa chaperonin 2 OS=Anabaena sp. (strain PCC 71... [more]
CH601_TRIEI2.856e-3454.1160 kDa chaperonin 1 OS=Trichodesmium erythraeum (s... [more]
CH602_SYNP64.871e-3450.9760 kDa chaperonin 2 OS=Synechococcus sp. (strain A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M06_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835719 ID=CF835719|Name=CF835719|organism=Citrus sinensis|type=EST|length=767bp
TTAAAGAGAAGAAGTTGAGAGTCGAAGATGCTCTTAATGCAACAAAGGCT
GCAGTTGAGGAAGGTATCGTAGTTGGTGGCGGATGTACTCTACTGAGACT
CTCATCTAAGGTGGATGCCATTAAGGAAACCCTTGATAATGATGAAGAAA
AGGTTGGAGCAGATATTGTTAAAAGAGCTCTGTGCTACCCACTGAAATTA
ATTGCCAAAAATGCCGGTGTTAATGGAAGTGTGGTCAGCGAGAAGGTGCT
TTCAAGTGACAATCATAAATATGGATACAATGCTGCAACTGGAAACTACG
AAGATCTAATGGCTGCAGGAATTATTGATCCTACCAAGGTGGTTAGATGT
TGCTTGGAGCATGCTTCCTCGGTGGCAAAAACCTTCTTGATGTCCGACTG
TGTGGTGGTTGAGATCAAGGAGCCTGAACCCGCTATGCCTGCGGGTAACC
CTATGGACAACTCAGGATATGGATACTAAGCTAATTAACAAGGTCACGGG
AGGCAAGCAAATAAGGTTCTGACTTCGTTATAGCAACTATCTTTCAGTTT
GACAGCGTTGGGTTCTCTTCTTCTTGTAAATTCAATTACTCGACTTAGTA
GAGTTTATGGATTCTGGTGAGGATAGCTTGCCAGAGTACGGCTCGTATTA
ATTTGCAATTAGATGTACAATTGCAATGATTTTGAACTTTTTGAGTGAAA
GAAATTTTATTTTGCTCATCTCCTTCACAGTCTGATACTAATTCTGCGGG
TACTCACATTTGTTACT
back to top