CF835722

Overview
NameCF835722
Unique NameCF835722
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length853
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1125 contig Csv1_Contig1125:12..864. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHI4_ORYSJ (Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht4 PE=2 SV=2)

HSP 1 Score: 295.434 bits (755), Expect = 2.621e-79
Identity = 138/203 (67.98%), Postives = 163/203 (80.30%), Query Frame = -3
Query:  153 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSG-SPEVSKREIAAFFAHVTHETGHLCYIEEINKSNR-YCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 755
            +V S+VT  FF+GIKNQA   CAGKSFYTR +FLNAA++Y  F +  + + SKREIAAFFAHVTHETGH+CYI EIN +N  YCD+ NKQ+PC PGK YYGRGP+Q++ N NYG AGK IGFDGLR P+ VA+DP +SFKTALWFWM NVH VM+QGFGATI+ INGA+EC GK P  V AR+ YYKDYC +FGV+PG NL C
Sbjct:   83 SVESVVTEAFFNGIKNQAPNGCAGKSFYTRQSFLNAARSYSGFANDRTNDDSKREIAAFFAHVTHETGHMCYINEINGANMDYCDKSNKQWPCQPGKKYYGRGPLQISWNFNYGPAGKNIGFDGLRDPDKVAQDPTISFKTALWFWMNNVHQVMSQGFGATIRAINGALECNGKNPGAVNARVNYYKDYCRQFGVSPGGNLYC 285          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHIA_MAIZE (Endochitinase A OS=Zea mays PE=1 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 4.942e-78
Identity = 134/202 (66.34%), Postives = 156/202 (77.23%), Query Frame = -3
Query:  153 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSGSPEVS-KREIAAFFAHVTHETGHLCYIEEINKSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 755
            NVA++VT  FF+GIKNQA + C GK+FYTR AFL+A  AYP F  G  EV  KREIAAFFAHVTHETGH CYI EINKSN YCD  N+Q+PC  G+ YYGRGP+Q++ N NYG AG+ IGF+GL  P  VA+D V++FKTALWFWM NVH VM QGFGATI+ INGA+EC G  PAQ+ AR+GYYK YC +  V PGPNL C
Sbjct:   79 NVANVVTDAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHFCYISEINKSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMNNVHGVMPQGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQQLRVDPGPNLIC 280          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHI5_ORYSJ (Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht5 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.590e-76
Identity = 135/203 (66.50%), Postives = 159/203 (78.33%), Query Frame = -3
Query:  153 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSG-SPEVSKREIAAFFAHVTHETGHLCYIEEINKSNR-YCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 755
            +V S+VT  FF+GIKNQA   CAGK+FYTR +FLNAA +Y  F    + + SKREIAAFFAHVTHETGH+CYI EIN ++  YCD+ NKQ+PC PGK YYGRGP+Q++ N NYG AG+ IGFDGLR P+ VA+DP +SFKTALWFWM NVH VM QGFGATI+ INGA+EC GK P  V AR+ YYKDYC +FGV PG NL C
Sbjct:   86 SVESVVTEAFFNGIKNQAPNGCAGKNFYTRQSFLNAAHSYSGFARDRTNDDSKREIAAFFAHVTHETGHMCYINEINGASMDYCDKNNKQWPCQPGKKYYGRGPLQISWNYNYGPAGQNIGFDGLRDPDRVAQDPTISFKTALWFWMNNVHQVMLQGFGATIRAINGALECNGKNPGAVNARVNYYKDYCRQFGVDPGGNLYC 288          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHIB_MAIZE (Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.346e-75
Identity = 129/202 (63.86%), Postives = 154/202 (76.24%), Query Frame = -3
Query:  153 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSGSPEVS-KREIAAFFAHVTHETGHLCYIEEINKSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 755
            NVAS+VT  FF+GIKNQA + C GK+FYTR AFL+A K YP F  G  +V  KREIAAFFAH THETGH CYI EINKSN YCD   +Q+PC  G+ YYGRGP+Q++ N NYG AG+AIGFDGL  P  VA+D VV+FK ALWFWM +VH V+ QGFGAT + +  A+ECGG  PAQ+ AR+GYY+ YC + GV PGPNL+C
Sbjct:   68 NVASVVTSSFFNGIKNQAGSGCEGKNFYTRSAFLSAVKGYPGFAHGGSQVQGKREIAAFFAHATHETGHFCYISEINKSNAYCDPTKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAVVAFKAALWFWMNSVHGVVPQGFGATTRAMQRALECGGNNPAQMNARVGYYRQYCRQLGVDPGPNLTC 269          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHI4_BRANA (Basic endochitinase CHB4 OS=Brassica napus PE=1 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 1.882e-69
Identity = 123/202 (60.89%), Postives = 151/202 (74.75%), Query Frame = -3
Query:  153 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSGSPEVSKREIAAFFAHVTHETGHLCYIEEINKSNR-YCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 755
            +V SIVT  FF+GI NQA   CAGK+FYTRD+F+NAA  +P F +    V++REIA  FAH THETGH CYIEEIN ++R YCDE N+QYPC PGK Y+GRGPIQL+ N NYGA G+++  + L  PE V+ +P V+F+T LWFWM +V PV+NQGFGATI+ ING +EC G     V ARI YY+DYC + GV PGPNLSC
Sbjct:   71 SVGSIVTQAFFNGIINQAGGGCAGKNFYTRDSFINAANTFPNFANS---VTRREIATMFAHFTHETGHFCYIEEINGASRDYCDENNRQYPCAPGKGYFGRGPIQLSWNYNYGACGQSLNLNLLGQPELVSSNPTVAFRTGLWFWMNSVRPVLNQGFGATIRAING-MECNGGNSGAVNARIRYYRDYCGQLGVDPGPNLSC 268          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHI4_PHAVU (Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE=2 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.081e-68
Identity = 127/202 (62.87%), Postives = 153/202 (75.74%), Query Frame = -3
Query:  153 ASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGS-GSPEVSKREIAAFFAHVTHETGHLCYIEEINKSNR-YCDEQN-KQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 749
            A I+T  F +GI +QA + CAGK+FYTRDAFL+A  +Y  FG  GS + SKREIAA FAH THETGH CYIEEI+ +++ YCDE++  QYPC   K Y+GRGPIQL+ N NYG AG A  FDGL APETV+ D VVSFKTALW+WM +V PV+NQGFGATI+ INGA+EC G  P  VQAR+ YY +YC + GVA G NL+C
Sbjct:   69 ADILTADFLNGIIDQADSGCAGKNFYTRDAFLSALNSYTDFGRVGSEDDSKREIAAAFAHFTHETGHFCYIEEIDGASKDYCDEESIAQYPCSSSKGYHGRGPIQLSWNFNYGPAGSANNFDGLGAPETVSNDVVVSFKTALWYWMQHVRPVINQGFGATIRAINGALECDGANPTTVQARVNYYTEYCRQLGVATGDNLTC 270          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHI6_ORYSJ (Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht6 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 5.126e-67
Identity = 123/205 (60.00%), Postives = 150/205 (73.17%), Query Frame = -3
Query:  153 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFG-SGSPEVSKREIAAFFAHVTHETGHLCYIEEIN-KSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHP--VMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 755
            +VASIVTP+FF  +  QA   CA K FYTRDAFL AA  YP FG +GS + SKREIAAFFAH  HET   CYIEEI+  S  YCDE + Q+PC+ GK YYGRGP+Q++ N NYG AG++IGFDGL  P+ VA+ PV++F+TALW+W  NVH   V  QGFGATI+ INGA+EC GK P  V  R+ YY+ +C +FGV PG NL+C
Sbjct:   67 SVASIVTPEFFAALVAQADDGCAAKGFYTRDAFLTAAGGYPSFGRTGSVDDSKREIAAFFAHANHETIKFCYIEEIDGPSKNYCDETSTQWPCMAGKGYYGRGPLQISWNFNYGPAGQSIGFDGLGDPDAVARSPVLAFQTALWYWTNNVHDAFVSGQGFGATIRAINGALECDGKNPTAVSNRVAYYQQFCQQFGVDPGSNLTC 271          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHIP_BETVU (Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 PE=1 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.396e-64
Identity = 125/205 (60.98%), Postives = 150/205 (73.17%), Query Frame = -3
Query:  153 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGS-GSPEVSKREIAAFFAHVTHETGHLCYIEEINKS--NRYCDEQNK-QYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 755
            +V+ IV+  FFDGI  QAAASC GK+FYTR AFL+A    P+FG+ GS + +KREIAAFFAH++HET +LC+IEE +    + YCD+    QYPC  GK YYGRGP+QL+ N NY  AG+AIGFDGL  PE VA D   SFK A+WFWMTNVH VMNQGFGAT + INGA+EC G+   Q   RI +YK YC  FGVAPG NL+C
Sbjct:   86 SVSDIVSQAFFDGIIGQAAASCPGKNFYTRAAFLSAVD--PKFGNEGSSDDNKREIAAFFAHISHETTNLCHIEERDGDVGDAYCDQDKAAQYPCAAGKKYYGRGPLQLSWNYNYALAGQAIGFDGLGNPEKVATDVNTSFKAAMWFWMTNVHSVMNQGFGATTKAINGALECNGQNQDQANDRIQFYKKYCADFGVAPGDNLTC 288          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHIT_DIOJA (Acidic endochitinase OS=Dioscorea japonica PE=1 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 2.016e-63
Identity = 122/206 (59.22%), Postives = 152/206 (73.79%), Query Frame = -3
Query:  153 VASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSG-SPEVSKREIAAFFAHVTHETGHLCYIEEIN-KSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWM-TNVHPVM---NQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 752
            V+ IVT +F+DGI +QAAA+C GKSFYTR  FL A  AYP FG+  + E  KREIAA+FAHVTHETGHLCYIEE +  +N YC E ++QYPC P K Y+GRGP+QL+ N NY  AGK + FDGL  P+ V +DP++SFKT+LWFW+   V  V+   NQGFGATI+ ING  EC G   AQ+ AR+GYY++YC + GV+PG NL C
Sbjct:   46 VSDIVTQEFWDGIASQAAANCPGKSFYTRSNFLEAVSAYPGFGTKCTDEDRKREIAAYFAHVTHETGHLCYIEERDGHANNYCQE-SQQYPCNPNKEYFGRGPMQLSWNYNYIDAGKELHFDGLNDPDIVGRDPIISFKTSLWFWIRKGVQYVILDPNQGFGATIRIINGGQECDGHNTAQMMARVGYYQEYCAQLGVSPGNNLPC 250          
BLAST of CF835722 vs. ExPASy Swiss-Prot
Match: CHI10_ORYSJ (Chitinase 10 OS=Oryza sativa subsp. japonica GN=Cht10 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.714e-46
Identity = 101/236 (42.80%), Postives = 135/236 (57.20%), Query Frame = -3
Query:  153 VASIVTPQFFDGI-KNQAAASCAGKSFYTRDAFLNAAKAYPQFGS-GSPEVSKREIAAFFAHVTHETGH-------------LCYIEEINKSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMT------NVHPVM---------------NQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYCNKFGVAPGPNLSC 752
            V+SIV+ Q +  +  ++  A+C  + FYT  +F+ AA  +P+F + G  +  KRE+AAF A ++HET               LCY EEIN  + YCD  +KQ+PC PGK Y+GRGPIQ++ N NYG AG+A+GFDGLR PE VA    ++F+TALWFWMT      + H VM                 GFG     +NG +EC     A+V  RIG+Y+ YC   GV  GPNL C
Sbjct:   49 VSSIVSEQLYASLFLHKDDAACPARGFYTYASFVRAATRFPRFAATGCADARKREVAAFLAQISHETTGGWATAPDGPYAWGLCYKEEINPQSSYCDATDKQWPCYPGKSYHGRGPIQISWNFNYGPAGQALGFDGLRNPEIVANCSDIAFQTALWFWMTPRDTKPSCHQVMVGEYRPGPADVAANRTAGFGLVTNIVNGGLECNRAGDARVNNRIGFYRRYCQVLGVDVGPNLDC 284          
The following BLAST results are available for this feature:
BLAST of CF835722 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI4_ORYSJ2.621e-7967.98Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIA_MAIZE4.942e-7866.34Endochitinase A OS=Zea mays PE=1 SV=1[more]
CHI5_ORYSJ1.590e-7666.50Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIB_MAIZE1.346e-7563.86Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1[more]
CHI4_BRANA1.882e-6960.89Basic endochitinase CHB4 OS=Brassica napus PE=1 SV... [more]
CHI4_PHAVU2.081e-6862.87Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE... [more]
CHI6_ORYSJ5.126e-6760.00Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIP_BETVU1.396e-6460.98Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 P... [more]
CHIT_DIOJA2.016e-6359.22Acidic endochitinase OS=Dioscorea japonica PE=1 SV... [more]
CHI10_ORYSJ1.714e-4642.80Chitinase 10 OS=Oryza sativa subsp. japonica GN=Ch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M08_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835722 ID=CF835722|Name=CF835722|organism=Citrus sinensis|type=EST|length=853bp
TTTTTTTTTTTTTTTTTAAGCATAAAATATGGTCGGCAACACCCTTTTAT
TACTTCAATTTATTTTGTTTTAGGTATATGAAACCACCCTATATTATAAA
ATTACACCACATTATTTCAACAAGCCAGTGAAGTATCGGCGAAAACATTT
TAACAAGAGAGATTTGGGCCAGGAGCAACACCAAATTTGTTGCAATAATC
CTTATAATATCCAATGCGAGCTTGAACCTGAGCAGGTTGCTTGCCACCGC
ATTCAACGGCACCATTGATTCTCTGAATTGTTGCACCAAAACCTTGGTTC
ATAACTGGGTGCACATTGGTCATCCAAAACCACAAGGCAGTCTTAAATGA
CACAACGGGGTCCTTGGCCACCGTTTCCGGAGCTCTTAATCCGTCAAACC
CGATGGCTTTTCCGGCAGCTCCGTAGTTTCCATTTCCGGTGAGTTGGATC
GGTCCACGGCCGTAGTAGAACTTTCCGGGAACACATGGGTACTGTTTGTT
TTGTTCATCACAGTACCGGTTGGACTTGTTAATCTCTTCTATGTAGCACA
AATGTCCAGTTTCATGAGTGACGTGTGCAAAAAATGCAGCAATCTCACGC
TTCGAAACTTCAGGAGAGCCGCTACCAAATTGAGGATAAGCCTTGGCAGC
ATTCAGAAACGCATCTCTCGTGTAGAAGCTCTTGCCGGCACAACTCGCGG
CTGCCTGATTCTTTATGCCGTCGAAGAACTGGGGAGTCACAATGCTAGCA
ACATTTTGACACATTACTTTGGTGGGAAAAGCTAGGGCAAGAATGCCCAC
AAGAGCAAAGGTTACAATATTTTTTTTCATGTTAAGTGGAGCCATTTTGT
TTA
back to top