CF835723

Overview
NameCF835723
Unique NameCF835723
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length673
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1125 contig Csv1_Contig1125:1..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHI4_ORYSJ (Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht4 PE=2 SV=2)

HSP 1 Score: 277.715 bits (709), Expect = 3.806e-74
Identity = 130/190 (68.42%), Postives = 153/190 (80.53%), Query Frame = 2
Query:  110 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSG-SPEVSKREIAAFFAHVTHETGHLCYIEEINKSNR-YCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            +V S+VT  FF+GIKNQA   CAGKSFYTR +FLNAA++Y  F +  + + SKREIAAFFAHVTHETGH+CYI EIN +N  YCD+ NKQ+PC PGK YYGRGP+Q++ N NYG AGK IGFDGLR P+ VA+DP +SFKTALWFWM NVH VM+QGFGATI+ INGA+EC GK P  V AR+ YYKDYC
Sbjct:   83 SVESVVTEAFFNGIKNQAPNGCAGKSFYTRQSFLNAARSYSGFANDRTNDDSKREIAAFFAHVTHETGHMCYINEINGANMDYCDKSNKQWPCQPGKKYYGRGPLQISWNFNYGPAGKNIGFDGLRDPDKVAQDPTISFKTALWFWMNNVHQVMSQGFGATIRAINGALECNGKNPGAVNARVNYYKDYC 272          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHIA_MAIZE (Endochitinase A OS=Zea mays PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 8.479e-74
Identity = 127/189 (67.20%), Postives = 148/189 (78.31%), Query Frame = 2
Query:  110 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSGSPEVS-KREIAAFFAHVTHETGHLCYIEEINKSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            NVA++VT  FF+GIKNQA + C GK+FYTR AFL+A  AYP F  G  EV  KREIAAFFAHVTHETGH CYI EINKSN YCD  N+Q+PC  G+ YYGRGP+Q++ N NYG AG+ IGF+GL  P  VA+D V++FKTALWFWM NVH VM QGFGATI+ INGA+EC G  PAQ+ AR+GYYK YC
Sbjct:   79 NVANVVTDAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHFCYISEINKSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMNNVHGVMPQGFGATIRAINGALECNGNNPAQMNARVGYYKQYC 267          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHI5_ORYSJ (Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht5 PE=2 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 1.037e-71
Identity = 127/190 (66.84%), Postives = 150/190 (78.95%), Query Frame = 2
Query:  110 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSG-SPEVSKREIAAFFAHVTHETGHLCYIEEINKSNR-YCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            +V S+VT  FF+GIKNQA   CAGK+FYTR +FLNAA +Y  F    + + SKREIAAFFAHVTHETGH+CYI EIN ++  YCD+ NKQ+PC PGK YYGRGP+Q++ N NYG AG+ IGFDGLR P+ VA+DP +SFKTALWFWM NVH VM QGFGATI+ INGA+EC GK P  V AR+ YYKDYC
Sbjct:   86 SVESVVTEAFFNGIKNQAPNGCAGKNFYTRQSFLNAAHSYSGFARDRTNDDSKREIAAFFAHVTHETGHMCYINEINGASMDYCDKNNKQWPCQPGKKYYGRGPLQISWNYNYGPAGQNIGFDGLRDPDRVAQDPTISFKTALWFWMNNVHQVMLQGFGATIRAINGALECNGKNPGAVNARVNYYKDYC 275          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHIB_MAIZE (Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.355e-70
Identity = 121/189 (64.02%), Postives = 144/189 (76.19%), Query Frame = 2
Query:  110 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSGSPEVS-KREIAAFFAHVTHETGHLCYIEEINKSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            NVAS+VT  FF+GIKNQA + C GK+FYTR AFL+A K YP F  G  +V  KREIAAFFAH THETGH CYI EINKSN YCD   +Q+PC  G+ YYGRGP+Q++ N NYG AG+AIGFDGL  P  VA+D VV+FK ALWFWM +VH V+ QGFGAT + +  A+ECGG  PAQ+ AR+GYY+ YC
Sbjct:   68 NVASVVTSSFFNGIKNQAGSGCEGKNFYTRSAFLSAVKGYPGFAHGGSQVQGKREIAAFFAHATHETGHFCYISEINKSNAYCDPTKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAVVAFKAALWFWMNSVHGVVPQGFGATTRAMQRALECGGNNPAQMNARVGYYRQYC 256          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHI4_PHAVU (Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE=2 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 4.664e-64
Identity = 120/189 (63.49%), Postives = 144/189 (76.19%), Query Frame = 2
Query:  116 ASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGS-GSPEVSKREIAAFFAHVTHETGHLCYIEEINKSNR-YCDEQN-KQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            A I+T  F +GI +QA + CAGK+FYTRDAFL+A  +Y  FG  GS + SKREIAA FAH THETGH CYIEEI+ +++ YCDE++  QYPC   K Y+GRGPIQL+ N NYG AG A  FDGL APETV+ D VVSFKTALW+WM +V PV+NQGFGATI+ INGA+EC G  P  VQAR+ YY +YC
Sbjct:   69 ADILTADFLNGIIDQADSGCAGKNFYTRDAFLSALNSYTDFGRVGSEDDSKREIAAAFAHFTHETGHFCYIEEIDGASKDYCDEESIAQYPCSSSKGYHGRGPIQLSWNFNYGPAGSANNFDGLGAPETVSNDVVVSFKTALWYWMQHVRPVINQGFGATIRAINGALECDGANPTTVQARVNYYTEYC 257          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHI4_BRANA (Basic endochitinase CHB4 OS=Brassica napus PE=1 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 1.357e-63
Identity = 114/189 (60.32%), Postives = 141/189 (74.60%), Query Frame = 2
Query:  110 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSGSPEVSKREIAAFFAHVTHETGHLCYIEEINKSNR-YCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            +V SIVT  FF+GI NQA   CAGK+FYTRD+F+NAA  +P F +    V++REIA  FAH THETGH CYIEEIN ++R YCDE N+QYPC PGK Y+GRGPIQL+ N NYGA G+++  + L  PE V+ +P V+F+T LWFWM +V PV+NQGFGATI+ ING +EC G     V ARI YY+DYC
Sbjct:   71 SVGSIVTQAFFNGIINQAGGGCAGKNFYTRDSFINAANTFPNFANS---VTRREIATMFAHFTHETGHFCYIEEINGASRDYCDENNRQYPCAPGKGYFGRGPIQLSWNYNYGACGQSLNLNLLGQPELVSSNPTVAFRTGLWFWMNSVRPVLNQGFGATIRAING-MECNGGNSGAVNARIRYYRDYC 255          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHI6_ORYSJ (Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht6 PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 9.724e-62
Identity = 115/192 (59.90%), Postives = 140/192 (72.92%), Query Frame = 2
Query:  110 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFG-SGSPEVSKREIAAFFAHVTHETGHLCYIEEIN-KSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHP--VMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            +VASIVTP+FF  +  QA   CA K FYTRDAFL AA  YP FG +GS + SKREIAAFFAH  HET   CYIEEI+  S  YCDE + Q+PC+ GK YYGRGP+Q++ N NYG AG++IGFDGL  P+ VA+ PV++F+TALW+W  NVH   V  QGFGATI+ INGA+EC GK P  V  R+ YY+ +C
Sbjct:   67 SVASIVTPEFFAALVAQADDGCAAKGFYTRDAFLTAAGGYPSFGRTGSVDDSKREIAAFFAHANHETIKFCYIEEIDGPSKNYCDETSTQWPCMAGKGYYGRGPLQISWNFNYGPAGQSIGFDGLGDPDAVARSPVLAFQTALWYWTNNVHDAFVSGQGFGATIRAINGALECDGKNPTAVSNRVAYYQQFC 258          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHIT_DIOJA (Acidic endochitinase OS=Dioscorea japonica PE=1 SV=2)

HSP 1 Score: 227.639 bits (579), Expect = 4.517e-59
Identity = 115/193 (59.59%), Postives = 143/193 (74.09%), Query Frame = 2
Query:  113 VASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGSG-SPEVSKREIAAFFAHVTHETGHLCYIEEIN-KSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWM-TNVHPVM---NQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            V+ IVT +F+DGI +QAAA+C GKSFYTR  FL A  AYP FG+  + E  KREIAA+FAHVTHETGHLCYIEE +  +N YC E ++QYPC P K Y+GRGP+QL+ N NY  AGK + FDGL  P+ V +DP++SFKT+LWFW+   V  V+   NQGFGATI+ ING  EC G   AQ+ AR+GYY++YC
Sbjct:   46 VSDIVTQEFWDGIASQAAANCPGKSFYTRSNFLEAVSAYPGFGTKCTDEDRKREIAAYFAHVTHETGHLCYIEERDGHANNYCQE-SQQYPCNPNKEYFGRGPMQLSWNYNYIDAGKELHFDGLNDPDIVGRDPIISFKTSLWFWIRKGVQYVILDPNQGFGATIRIINGGQECDGHNTAQMMARVGYYQEYC 237          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHIP_BETVU (Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.517e-59
Identity = 116/192 (60.42%), Postives = 140/192 (72.92%), Query Frame = 2
Query:  110 NVASIVTPQFFDGIKNQAAASCAGKSFYTRDAFLNAAKAYPQFGS-GSPEVSKREIAAFFAHVTHETGHLCYIEEINKS--NRYCDEQNK-QYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMTNVHPVMNQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            +V+ IV+  FFDGI  QAAASC GK+FYTR AFL+A    P+FG+ GS + +KREIAAFFAH++HET +LC+IEE +    + YCD+    QYPC  GK YYGRGP+QL+ N NY  AG+AIGFDGL  PE VA D   SFK A+WFWMTNVH VMNQGFGAT + INGA+EC G+   Q   RI +YK YC
Sbjct:   86 SVSDIVSQAFFDGIIGQAAASCPGKNFYTRAAFLSAVD--PKFGNEGSSDDNKREIAAFFAHISHETTNLCHIEERDGDVGDAYCDQDKAAQYPCAAGKKYYGRGPLQLSWNYNYALAGQAIGFDGLGNPEKVATDVNTSFKAAMWFWMTNVHSVMNQGFGATTKAINGALECNGQNQDQANDRIQFYKKYC 275          
BLAST of CF835723 vs. ExPASy Swiss-Prot
Match: CHI10_ORYSJ (Chitinase 10 OS=Oryza sativa subsp. japonica GN=Cht10 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.724e-42
Identity = 94/223 (42.15%), Postives = 128/223 (57.40%), Query Frame = 2
Query:  113 VASIVTPQFFDGI-KNQAAASCAGKSFYTRDAFLNAAKAYPQFGS-GSPEVSKREIAAFFAHVTHETGH-------------LCYIEEINKSNRYCDEQNKQYPCVPGKFYYGRGPIQLTGNGNYGAAGKAIGFDGLRAPETVAKDPVVSFKTALWFWMT------NVHPVM---------------NQGFGATIQRINGAVECGGKQPAQVQARIGYYKDYC 673
            V+SIV+ Q +  +  ++  A+C  + FYT  +F+ AA  +P+F + G  +  KRE+AAF A ++HET               LCY EEIN  + YCD  +KQ+PC PGK Y+GRGPIQ++ N NYG AG+A+GFDGLR PE VA    ++F+TALWFWMT      + H VM                 GFG     +NG +EC     A+V  RIG+Y+ YC
Sbjct:   49 VSSIVSEQLYASLFLHKDDAACPARGFYTYASFVRAATRFPRFAATGCADARKREVAAFLAQISHETTGGWATAPDGPYAWGLCYKEEINPQSSYCDATDKQWPCYPGKSYHGRGPIQISWNFNYGPAGQALGFDGLRNPEIVANCSDIAFQTALWFWMTPRDTKPSCHQVMVGEYRPGPADVAANRTAGFGLVTNIVNGGLECNRAGDARVNNRIGFYRRYC 271          
The following BLAST results are available for this feature:
BLAST of CF835723 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI4_ORYSJ3.806e-7468.42Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIA_MAIZE8.479e-7467.20Endochitinase A OS=Zea mays PE=1 SV=1[more]
CHI5_ORYSJ1.037e-7166.84Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIB_MAIZE4.355e-7064.02Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1[more]
CHI4_PHAVU4.664e-6463.49Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE... [more]
CHI4_BRANA1.357e-6360.32Basic endochitinase CHB4 OS=Brassica napus PE=1 SV... [more]
CHI6_ORYSJ9.724e-6259.90Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIT_DIOJA4.517e-5959.59Acidic endochitinase OS=Dioscorea japonica PE=1 SV... [more]
CHIP_BETVU4.517e-5960.42Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 P... [more]
CHI10_ORYSJ1.724e-4242.15Chitinase 10 OS=Oryza sativa subsp. japonica GN=Ch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M08_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835723 ID=CF835723|Name=CF835723|organism=Citrus sinensis|type=EST|length=673bp
TTTCTCTACTCCTAATAAAATGGCTCCACTTAACATGAAAAAAAATATTG
TAACCTTTGCTCTTGTGGGCATTCTTGCCCTAGCTTTTCCCACCAAAGTA
ATGTGTCAAAATGTTGCTAGCATTGTGACTCCCCAGTTCTTCGACGGCAT
AAAGAATCAGGCAGCCGCGAGTTGTGCCGGCAAGAGCTTCTACACGAGAG
ATGCGTTTCTGAATGCTGCCAAGGCTTATCCTCAATTTGGTAGCGGCTCT
CCTGAAGTTTCGAAGCGTGAGATTGCTGCATTTTTTGCACACGTCACTCA
TGAAACTGGACATTTGTGCTACATAGAAGAGATTAACAAGTCCAACCGGT
ACTGTGATGAACAAAACAAACAGTACCCATGTGTTCCCGGAAAGTTCTAC
TACGGCCGTGGACCGATCCAACTCACCGGAAATGGAAACTACGGAGCTGC
CGGAAAAGCCATCGGGTTTGACGGATTAAGAGCTCCGGAAACGGTGGCCA
AGGACCCCGTTGTGTCATTTAAGACTGCCTTGTGGTTTTGGATGACCAAT
GTGCACCCAGTTATGAACCAAGGTTTTGGTGCAACAATTCAGAGAATCAA
TGGTGCCGTTGAATGCGGTGGCAAGCAACCTGCTCAGGTTCAAGCTCGCA
TTGGATATTATAAGGATTATTGC
back to top