CF835726

Overview
NameCF835726
Unique NameCF835726
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length838
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8816 contig Csv1_Contig8816:97..938. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835726 vs. ExPASy Swiss-Prot
Match: TSJT1_TOBAC (Stem-specific protein TSJT1 OS=Nicotiana tabacum GN=TSJT1 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.459e-21
Identity = 45/80 (56.25%), Postives = 60/80 (75.00%), Query Frame = -2
Query:  595 RSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYPPNHVVGHLSGYFAFIVYDKSTSTLFVA 834
            RS  V D++FC+F GALDN   LR+ YGL++ A E ++++EAYK LRDRAPYPP+ V+  L G FAFI++D   STLF+A
Sbjct:   69 RSIVVMDDVFCIFSGALDNTFDLRKHYGLSRQATEAMIMVEAYKVLRDRAPYPPDQVIKELEGKFAFILFDSKASTLFLA 148          
The following BLAST results are available for this feature:
BLAST of CF835726 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TSJT1_TOBAC2.459e-2156.25Stem-specific protein TSJT1 OS=Nicotiana tabacum G... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835726 ID=CF835726|Name=CF835726|organism=Citrus sinensis|type=EST|length=838bp
TTTTTTTTTTTTTAGTTCGAACACTGGGACAAGACTTTATCCCCTAAAAA
CATAACTGTACATTGGACCACACTGGATAACCTGTTAATTTGAAAGNAAA
NACCTAAGAAACTTGAAAGGAGCTATAGCTACAAAGAAAGCTGGGTGCTA
CATTTCTCACAAGCATACACTATTTCCATTCCAGTTGATATTTTGCTACA
CTCATTTTGTTATTCACATGGACCCTCTTGCAGCTTGCATCCCCACAAAC
TTTTTTTCCCCCAAACCGCCGATTTTTAACTGTTGGCTAATATCTCAAGT
CGAGAAGAAATATCTTCTAGCCTTCTACTCTGTGGCTGCAAGAACTGCTG
GCCCTTCCACCTTAAATGTAGCACCCCAGATCTCTTCTTCCGCAGCAGGA
ACTGCAGTGATCTTGTTCTTTGGATTCTCAAAGCTTCTCAGTCCTCCAAC
TGCTGTTGAGAAGAAACAACCTTGAGGGAAAGAAGCAAGTGACTTGCCGC
AAGCACCTTTGAGCAAGTCAGCATCATCAGCAAAGGCAACATGTCCATCA
GCAGTGATTCCCCAATAAAGAGGAACCTTACCAAATTGGTCAGAAGCCAC
AAACAAGGTGGAGGTGGACTTGTCGTAGACAATGAAGGCAAAGTACCCAC
TAAGGTGGCCAACGACATGGTTCGGTGGGTAAGGGGCCCGATCACGCAGA
GCCTTGTATGCCTCAATCACCAAGATCACTTCATTTGCCGACTTAGCTAG
TCCATATTGCTGCCTCAGGCTTCCCAAGTTATCAAGTGCTCCCTCAAACA
AGCAGAAGATCTCATCTTTCACAGCAAATGATCTTTGC
back to top