CF835727

Overview
NameCF835727
Unique NameCF835727
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length788
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8816 contig Csv1_Contig8816:465..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835727 vs. ExPASy Swiss-Prot
Match: TSJT1_TOBAC (Stem-specific protein TSJT1 OS=Nicotiana tabacum GN=TSJT1 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.425e-28
Identity = 65/149 (43.62%), Postives = 92/149 (61.74%), Query Frame = 1
Query:  118 MLGVFSSAIVSPPEELVA--AGSRTPSPKTTSTALVDRFLQANSSAVSVQVGDNVTLAYTHQNESPLRQRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYPPNHVVGHLSGYFAFIVYDKSTSTLFVA 558
            ML VF  +I  PP EL    AG +    KT    + + F      +    + +   +A++H NE+PL+ RS  V D++FC+F GALDN   LR+ YGL++ A E ++++EAYK LRDRAPYPP+ V+  L G FAFI++D   STLF+A
Sbjct:    1 MLAVFEQSIGRPPPELSLPQAGIQKKEAKTREE-IAESFKTWKQDSTFYHLFNGNFMAFSHGNENPLQPRSIVVMDDVFCIFSGALDNTFDLRKHYGLSRQATEAMIMVEAYKVLRDRAPYPPDQVIKELEGKFAFILFDSKASTLFLA 148          
The following BLAST results are available for this feature:
BLAST of CF835727 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TSJT1_TOBAC1.425e-2843.62Stem-specific protein TSJT1 OS=Nicotiana tabacum G... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M11_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835727 ID=CF835727|Name=CF835727|organism=Citrus sinensis|type=EST|length=788bp
CGAGATTTGAACTCTTTAGTTAAAGCCAAAGAGTTCCGAACGGATCAAAG
TTTTCTTGTAGGAGAGAGAAATTTCTAGGGCGAGAAAGCGAGAGAAAAGG
AAATTTGGTAGCTTAAAATGTTGGGAGTGTTCAGCAGCGCGATCGTTTCA
CCTCCAGAGGAGCTGGTGGCGGCCGGAAGCCGGACTCCGTCGCCGAAGAC
CACATCGACGGCACTGGTCGACCGTTTCCTCCAGGCCAACTCGTCTGCTG
TGTCCGTACAGGTCGGGGACAACGTCACCCTCGCGTACACTCATCAGAAC
GAGTCTCCTTTACGGCAAAGATCATTTGCTGTGAAAGATGAGATCTTCTG
CTTGTTTGAGGGAGCACTTGATAACTTGGGAAGCCTGAGGCAGCAATATG
GACTAGCTAAGTCGGCAAATGAAGTGATCTTGGTGATTGAGGCATACAAG
GCTCTGCGTGATCGGGCCCCTTACCCACCGAACCATGTCGTTGGCCACCT
TAGTGGGTACTTTGCCTTCATTGTCTACGACAAGTCCACCTCCACCTTGT
TTGTGGCTTCTGACCAATTTGGTAAGGTTCCTCTTTATTGGGGAATCACT
GCTGATGGACATGTTGCCTTTGCTGATGATGCTGACTTGCTCAAAGGTGC
TTGCGGCAAGTCACTTGCTTCTTTCCCTCAAGGTTGTTTCTTCTCAACAG
CAGTTGGAGGACTGAGAAGCTTTGAGAATCCAAAGAACAAGATCACTGCA
GTTCCTGCTGCGGAAGAAGAGATCTGGGGTGCTACATT
back to top