CF835895

Overview
NameCF835895
Unique NameCF835895
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length621
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL191_ARATH (60S ribosomal protein L19-1 OS=Arabidopsis thaliana GN=RPL19A PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.409e-47
Identity = 101/154 (65.58%), Postives = 109/154 (70.78%), Query Frame = -1
Query:  160 FIIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAKNXXXXXXXXXXXXXXLPQGPGEKAVPAPQPAEGAKKA 621
            FIIRKPTKIHSRSRAR+MK AK KGR SGYGKRKG+REARLP K+             +KYRE+KKIDKHM HDMYM+VKGNVFKNKRVLMESI +SKAEKAREKTLSDQFEAKRAKN              L +GPG    P   PA  A  A
Sbjct:   49 FIIRKPTKIHSRSRARKMKIAKMKGRHSGYGKRKGTREARLPTKVLWMRRMRVLRRLLKKYRETKKIDKHMYHDMYMRVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKHARREERLAKGPGGDVAPVAAPAPAATPA 202          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL193_ARATH (60S ribosomal protein L19-3 OS=Arabidopsis thaliana GN=RPL19C PE=2 SV=3)

HSP 1 Score: 186.422 bits (472), Expect = 9.918e-47
Identity = 105/160 (65.62%), Postives = 115/160 (71.88%), Query Frame = -1
Query:  154 FIIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAKNXXXXXXXXXXXXXXLPQGPG---EKAVPAPQPAE-GAKKAKK 621
            FIIRKPTKIHSRSRAR++  AKRKGR SGYGKRKG+REARLP K+             +KYRE+KKID+HM HDMYMKVKGNVFKNKRVLMESI +SKAEKAREKTLSDQFEAKRAKN              L +GPG     A P  Q AE  AKK+KK
Sbjct:   49 FIIRKPTKIHSRSRARQLNIAKRKGRHSGYGKRKGTREARLPTKVLWMRRMRVLRRLLKKYRETKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKHARREERLAKGPGGDIPAAAPPAQTAEVPAKKSKK 208          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL192_ARATH (60S ribosomal protein L19-2 OS=Arabidopsis thaliana GN=RPL19B PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.295e-46
Identity = 105/160 (65.62%), Postives = 110/160 (68.75%), Query Frame = -1
Query:  154 FIIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAKNXXXXXXXXXXXXXXLPQGP--GEKAVP--APQPAEGAKKAKK 621
            FIIRKPTKIHSRSRAR + EAKRKGR SGYGKRKG+REARLP KI              KYRESKKID+HM HDMYMKVKGNVFKNKRVLMESI + KAEKAREKTL+DQFEAKR KN              L QGP  GE   P  APQ  E  KK  K
Sbjct:   49 FIIRKPTKIHSRSRARALNEAKRKGRHSGYGKRKGTREARLPTKILWMRRMRVLRRFLSKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKMKAEKAREKTLADQFEAKRIKNKASRERKFARREERLAQGPGGGETTTPAGAPQQPEVTKKKSK 208          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL19_DROME (60S ribosomal protein L19 OS=Drosophila melanogaster GN=RpL19 PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 7.629e-31
Identity = 66/116 (56.90%), Postives = 82/116 (70.69%), Query Frame = -1
Query:  271 IIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAK 618
            II+KP  +HSR R R+  EA+RKGR  G+GKRKG+  AR+P K+             +KYR+SKKID+H+ HD+YMK KGNVFKNKRVLME I + KAEK R K L+DQ EA+R K
Sbjct:   50 IIKKPVVVHSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQK 165          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL19_RAT (60S ribosomal protein L19 OS=Rattus norvegicus GN=Rpl19 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.301e-30
Identity = 66/116 (56.90%), Postives = 84/116 (72.41%), Query Frame = -1
Query:  271 IIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAK 618
            IIRKP  +HSR+R R+   A+RKGR  G GKRKG+  AR+P K+             R+YRESKKID+HM H +Y+KVKGNVFKNKR+LME I + KA+KAR+K L+DQ EA+R+K
Sbjct:   50 IIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSK 165          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL19_PONAB (60S ribosomal protein L19 OS=Pongo abelii GN=RPL19 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.301e-30
Identity = 66/116 (56.90%), Postives = 84/116 (72.41%), Query Frame = -1
Query:  271 IIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAK 618
            IIRKP  +HSR+R R+   A+RKGR  G GKRKG+  AR+P K+             R+YRESKKID+HM H +Y+KVKGNVFKNKR+LME I + KA+KAR+K L+DQ EA+R+K
Sbjct:   50 IIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSK 165          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL19_MOUSE (60S ribosomal protein L19 OS=Mus musculus GN=Rpl19 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.301e-30
Identity = 66/116 (56.90%), Postives = 84/116 (72.41%), Query Frame = -1
Query:  271 IIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAK 618
            IIRKP  +HSR+R R+   A+RKGR  G GKRKG+  AR+P K+             R+YRESKKID+HM H +Y+KVKGNVFKNKR+LME I + KA+KAR+K L+DQ EA+R+K
Sbjct:   50 IIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSK 165          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL19_MACFA (60S ribosomal protein L19 OS=Macaca fascicularis GN=RPL19 PE=2 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 1.301e-30
Identity = 66/116 (56.90%), Postives = 84/116 (72.41%), Query Frame = -1
Query:  271 IIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAK 618
            IIRKP  +HSR+R R+   A+RKGR  G GKRKG+  AR+P K+             R+YRESKKID+HM H +Y+KVKGNVFKNKR+LME I + KA+KAR+K L+DQ EA+R+K
Sbjct:   50 IIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSK 165          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL19_HUMAN (60S ribosomal protein L19 OS=Homo sapiens GN=RPL19 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.301e-30
Identity = 66/116 (56.90%), Postives = 84/116 (72.41%), Query Frame = -1
Query:  271 IIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAK 618
            IIRKP  +HSR+R R+   A+RKGR  G GKRKG+  AR+P K+             R+YRESKKID+HM H +Y+KVKGNVFKNKR+LME I + KA+KAR+K L+DQ EA+R+K
Sbjct:   50 IIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSK 165          
BLAST of CF835895 vs. ExPASy Swiss-Prot
Match: RL19_BOVIN (60S ribosomal protein L19 OS=Bos taurus GN=RPL19 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.301e-30
Identity = 66/116 (56.90%), Postives = 84/116 (72.41%), Query Frame = -1
Query:  271 IIRKPTKIHSRSRARRMKEAKRKGRPSGYGKRKGSREARLPPKIXXXXXXXXXXXXXRKYRESKKIDKHMSHDMYMKVKGNVFKNKRVLMESIPQSKAEKAREKTLSDQFEAKRAK 618
            IIRKP  +HSR+R R+   A+RKGR  G GKRKG+  AR+P K+             R+YRESKKID+HM H +Y+KVKGNVFKNKR+LME I + KA+KAR+K L+DQ EA+R+K
Sbjct:   50 IIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSK 165          
The following BLAST results are available for this feature:
BLAST of CF835895 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
RL191_ARATH3.409e-4765.5860S ribosomal protein L19-1 OS=Arabidopsis thalian... [more]
RL193_ARATH9.918e-4765.6360S ribosomal protein L19-3 OS=Arabidopsis thalian... [more]
RL192_ARATH1.295e-4665.6360S ribosomal protein L19-2 OS=Arabidopsis thalian... [more]
RL19_DROME7.629e-3156.9060S ribosomal protein L19 OS=Drosophila melanogast... [more]
RL19_RAT1.301e-3056.9060S ribosomal protein L19 OS=Rattus norvegicus GN=... [more]
RL19_PONAB1.301e-3056.9060S ribosomal protein L19 OS=Pongo abelii GN=RPL19... [more]
RL19_MOUSE1.301e-3056.9060S ribosomal protein L19 OS=Mus musculus GN=Rpl19... [more]
RL19_MACFA1.301e-3056.9060S ribosomal protein L19 OS=Macaca fascicularis G... [more]
RL19_HUMAN1.301e-3056.9060S ribosomal protein L19 OS=Homo sapiens GN=RPL19... [more]
RL19_BOVIN1.301e-3056.9060S ribosomal protein L19 OS=Bos taurus GN=RPL19 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_02B07_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835895 ID=CF835895; Name=CF835895; organism=Citrus sinensis; type=EST; length=621bp
GGGTCCACTTTAAAGGGTTTATAAGNAAATAATTTGCCATTAAACAGAAA
ACAAAATAACTTGGGAAACAAACTCCTACCCCCAAACCAGAACCAACATT
AACATATATAAGTTATCAATCTTCAGTCTCCATCATCGATGTATCAGCGA
TCACTTCTTAGCTTTCTTAGCTCCCTCAGCTGGTTGGGGGGCTGGTACTG
CCTTCTCTCCAGGTCCCTGGGGTAGTCGCTCTTCTCTCCTGGCCAGCTTT
CTCTCCCTGCTGGCCTTGTTCTTGGCGCGCTTAGCCTCAAACTGGTCAGA
AAGAGTCTTCTCTCTTGCCTTTTCAGCCTTTGACTGGGGGATACTCTCCA
TGAGGACACGCTTGTTCTTAAATACATTACCCTTGACCTTCATGTACATG
TCATGGGACATGTGCTTGTCAATTTTCTTCGACTCACGGTATTTGCGGAG
CAACCGCCTGAGCACACGCATCCTTCTCATCCAGAGGATTTTGGGGGGAA
GCCTCGCCTCCCTAGAACCCTTTCTCTTACCATATCCAGAGGGACGGCCC
TTCCTCTTGGCTTCCTTCATTCTGCGAGCGCGAGAACGGGAGTGGATCTT
TGTTGGCTTCCTGATGATGAA
back to top