CF835899

Overview
NameCF835899
Unique NameCF835899
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length820
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835899 vs. ExPASy Swiss-Prot
Match: CDC73_RAT (Parafibromin OS=Rattus norvegicus GN=Cdc73 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.487e-15
Identity = 43/104 (41.35%), Postives = 64/104 (61.54%), Query Frame = -1
Query:  521 VRDKPSTMKSEDWDRVVAVFVLGKEWQFKEWPF----KDHVEIFNKIIGFYMRFEDDSVESAKIVKQWNVKIISISKNKRHQDRAAALEVWDRLEEF-VRSRSH 817
            V D+P  +  +DWDRVVAVFV G  WQFK WP+       V+IF KI  F++++  D V     V++W+V ++ +S +KRH DR   L  W+ L+ + V+ +SH
Sbjct:  427 VVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKY--DEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSH 528          
BLAST of CF835899 vs. ExPASy Swiss-Prot
Match: CDC73_MOUSE (Parafibromin OS=Mus musculus GN=Cdc73 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.487e-15
Identity = 43/104 (41.35%), Postives = 64/104 (61.54%), Query Frame = -1
Query:  521 VRDKPSTMKSEDWDRVVAVFVLGKEWQFKEWPF----KDHVEIFNKIIGFYMRFEDDSVESAKIVKQWNVKIISISKNKRHQDRAAALEVWDRLEEF-VRSRSH 817
            V D+P  +  +DWDRVVAVFV G  WQFK WP+       V+IF KI  F++++  D V     V++W+V ++ +S +KRH DR   L  W+ L+ + V+ +SH
Sbjct:  427 VVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKY--DEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSH 528          
BLAST of CF835899 vs. ExPASy Swiss-Prot
Match: CDC73_HUMAN (Parafibromin OS=Homo sapiens GN=CDC73 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.487e-15
Identity = 43/104 (41.35%), Postives = 64/104 (61.54%), Query Frame = -1
Query:  521 VRDKPSTMKSEDWDRVVAVFVLGKEWQFKEWPF----KDHVEIFNKIIGFYMRFEDDSVESAKIVKQWNVKIISISKNKRHQDRAAALEVWDRLEEF-VRSRSH 817
            V D+P  +  +DWDRVVAVFV G  WQFK WP+       V+IF KI  F++++  D V     V++W+V ++ +S +KRH DR   L  W+ L+ + V+ +SH
Sbjct:  427 VVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKY--DEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSH 528          
BLAST of CF835899 vs. ExPASy Swiss-Prot
Match: CDC73_CHICK (Parafibromin OS=Gallus gallus GN=CDC73 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.487e-15
Identity = 43/104 (41.35%), Postives = 64/104 (61.54%), Query Frame = -1
Query:  521 VRDKPSTMKSEDWDRVVAVFVLGKEWQFKEWPF----KDHVEIFNKIIGFYMRFEDDSVESAKIVKQWNVKIISISKNKRHQDRAAALEVWDRLEEF-VRSRSH 817
            V D+P  +  +DWDRVVAVFV G  WQFK WP+       V+IF KI  F++++  D V     V++W+V ++ +S +KRH DR   L  W+ L+ + V+ +SH
Sbjct:  427 VVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKY--DEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSH 528          
BLAST of CF835899 vs. ExPASy Swiss-Prot
Match: CDC73_YEAST (Cell division control protein 73 OS=Saccharomyces cerevisiae GN=CDC73 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.010e-12
Identity = 36/91 (39.56%), Postives = 51/91 (56.04%), Query Frame = -1
Query:  521 KSEDWDRVVAVFVLGKEWQFKEWPFKDHVEIFNKIIGFYMRFEDDSVESAKIVKQWNVKIISISKNKRHQDRAAALEVWDRLEEFVRSRSH 793
            K E WDRVVA+F  G  WQF  + +    E+F +  G+Y  F  DSV   + V+QWNV+ + + KNKR +D       W  LE+ + SR +
Sbjct:  304 KPEYWDRVVAIFTTGHTWQFNNYQWNSPQELFQRCKGYYFHFAGDSV--PQHVQQWNVEKVELDKNKRFKDVEVVRYFWHSLEKELISRGY 392          
BLAST of CF835899 vs. ExPASy Swiss-Prot
Match: CDC73_SCHPO (Cell division control protein 73 OS=Schizosaccharomyces pombe GN=cdc73 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.303e-11
Identity = 30/89 (33.71%), Postives = 54/89 (60.67%), Query Frame = -1
Query:  527 KSEDWDRVVAVFVLGKEWQFKEWPFKDHVEIFNKIIGFYMRFEDDSVESAKIVKQWNVKIISISKNKRHQDRAAALEVWDRLEEFVRSR 793
            K + WDRVV VF  G+ WQF+++ + +  ++F+ + GF +++  D    A     WNV+ I + + +RH DR    ++WD+LE ++ +R
Sbjct:  277 KPDYWDRVVCVFTTGQAWQFRDYKWSEPHQLFHHVKGFLVQYVGDPPHPA--THDWNVEGIFVERLRRHTDREVVSQLWDKLERWMENR 363          
The following BLAST results are available for this feature:
BLAST of CF835899 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
CDC73_RAT1.487e-1541.35Parafibromin OS=Rattus norvegicus GN=Cdc73 PE=2 SV... [more]
CDC73_MOUSE1.487e-1541.35Parafibromin OS=Mus musculus GN=Cdc73 PE=2 SV=1[more]
CDC73_HUMAN1.487e-1541.35Parafibromin OS=Homo sapiens GN=CDC73 PE=1 SV=1[more]
CDC73_CHICK1.487e-1541.35Parafibromin OS=Gallus gallus GN=CDC73 PE=2 SV=1[more]
CDC73_YEAST2.010e-1239.56Cell division control protein 73 OS=Saccharomyces ... [more]
CDC73_SCHPO1.303e-1133.71Cell division control protein 73 OS=Schizosaccharo... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_02B10_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02B10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835899 ID=CF835899; Name=CF835899; organism=Citrus sinensis; type=EST; length=820bp
CCTTTTTTAGCACCAAACAAGATAGGACATTTGATTTATTATAAACAAAT
CTCGCTAGGGCCAAATCAACATAATGGAAGAAAACTGTTTTAAGTTAGTA
ACTAATAACCCTAATACATGGGATTACTACGTGATAGAAATCTAACTCTT
CAACTGATATAATTACTTGAAAAAGACATCCTTATCAACAGGAGATGAAA
AAGACAAAACATTTGCAGAGAAAAATCATAACTATGACTGCAGCAACGAA
ATATCTCATGAAAGATGATGGTATATCCATATGACCACTTCATTTCCTTC
TTAAACAAAGTCTGCACAAGCTCGCTTCATGCACAAGAAAATTCCCATTA
CATAGTCCGACAACATCCGGATAGCAAGCTCTGAGAAGATCAACTAAAAG
TTAGCAGTTGCATCTGGTTTAAATGCTGCATTGAGCCCAGCAAAATTTGT
CATCCAGAAGCAGAATCAGCTCTGATAAATCCTCTCTCACTGTGAAAAAA
ATATTCTTTGAATCTCAGGAATGTGACCGTGACCGCACAAATTCTTCTAG
TCTGTCCCATACTTCCAAGGCTGCGGCCCTGTCTTGGTGTCGCTTGTTCT
TGCTAATTGAAATGATTTTTACATTCCACTGCTTCACAATCTTTGCAGAC
TCTACACTGTCATCTTCAAACCGCATGTAGAATCCAATAATTTTATTAAA
AATCTCAACATGATCCTTAAAAGGCCACTCCTTGAACTGCCACTCTTTCC
CCAACACAAAAACTGCCACAACTCTATCCCAATCCTCGGACTTCATCGTG
GACGGCTTATCCCTCACCTC
back to top