CF835900

Overview
NameCF835900
Unique NameCF835900
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length740
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835900 vs. ExPASy Swiss-Prot
Match: CDC73_CHICK (Parafibromin OS=Gallus gallus GN=CDC73 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 9.252e-11
Identity = 35/110 (31.82%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  141 DPLSALRDFTIRSELDKVTQTGDEILFGSDYTFPSSIETAY----RSKQGN---LYTLQTVVYFIKHYNLKHTDYIQRARSNKLPAVTLPDRKPLYEYLTGVTDSADQIE 449
            D LS LR +  + +  ++   GDE++FG ++++P +++T Y      K+G     YTL ++++ + + +L H  Y++RA +  +P V  PDRK L  YL G T ++  I+
Sbjct:    3 DVLSVLRQYNTQKK--EIVVKGDEVIFG-EFSWPKNVKTNYVIWGTGKEGQPREYYTLDSILFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLAYLNGETSTSSSID 109          
The following BLAST results are available for this feature:
BLAST of CF835900 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
CDC73_CHICK9.252e-1131.82Parafibromin OS=Gallus gallus GN=CDC73 PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_02B10_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02B10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835900 ID=CF835900; Name=CF835900; organism=Citrus sinensis; type=EST; length=740bp
CTCGCCAGTCGCCATCCAGGTACTGCACAAAAAGGACCATCTAGTACTGA
GTGTGGAGCTGCAAGCGTAATCTGTCTTACCTCGTTCGCTCAGGGTCTCT
CAGTAGTCCCGTTTCCTTGTACTTTCACAACCTTCCAATGGACCCGCTAT
CGGCTCTCCGCGACTTCACAATTCGCAGCGAACTCGACAAGGTCACCCAA
ACCGGCGACGAAATCCTGTTCGGGTCGGACTACACATTCCCCAGCTCGAT
CGAGACCGCCTACCGGTCCAAGCAGGGCAACCTCTACACTCTCCAAACCG
TCGTGTATTTCATCAAACACTACAACCTCAAGCACACCGATTACATTCAA
AGAGCCCGCTCAAACAAGCTCCCCGCCGTCACCCTCCCCGACCGCAAACC
CCTCTACGAGTACCTCACCGGCGTTACCGACTCCGCCGACCAGATCGAAA
CCGTCATCGCCAACGACCACGTGTTGAACGACGGAAAGATTGTCGAGACC
GACGGCGGCGGGGATGATTTGGAATTGGACGATATAAGTTTGATTAGAGC
ATGTGAGAGGCCGTTGAAGGACAGAGAAGCGTTGTTGGAGTGTAAGGGTA
TTGATTTTTACAGCGTGCTTGTTTCGTCGACGAGGCGGGAGGAGGAGAGA
CAGAGGATTGAGTCGCAGCAGAGGAAGGACGGATTGGTTGCGAAGAATAG
GTTGATGGGTGTTGATGAGAGGGGAATTGGGTACGGTGGA
back to top