CF835903

Overview
NameCF835903
Unique NameCF835903
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length455
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835903 vs. ExPASy Swiss-Prot
Match: SF3BB_ARATH (Uncharacterized protein At4g14342 OS=Arabidopsis thaliana GN=At4g14342 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.734e-42
Identity = 79/87 (90.80%), Postives = 84/87 (96.55%), Query Frame = 3
Query:    3 MQASDTFNINSPLQHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYFAIAENESIGRERYNFMHKMLLPCGLPPEREDD 263
            MQASD FNINS L+HLQAKYVGTGHADL+RFEWAVNIQRDSYASYIGHYPML+YFAIAENESIGRERYNFM KMLLPCGLPPERE++
Sbjct:    1 MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWAVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYNFMQKMLLPCGLPPEREEE 87          
BLAST of CF835903 vs. ExPASy Swiss-Prot
Match: SF3BA_ARATH (Uncharacterized protein At3g23325 OS=Arabidopsis thaliana GN=At3g23325 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.734e-42
Identity = 79/87 (90.80%), Postives = 83/87 (95.40%), Query Frame = 3
Query:    3 MQASDTFNINSPLQHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYFAIAENESIGRERYNFMHKMLLPCGLPPEREDD 263
            MQASD FNINS L+HLQAKYVGTGHADL+RFEW VNIQRDSYASYIGHYPML+YFAIAENESIGRERYNFM KMLLPCGLPPERED+
Sbjct:    1 MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWTVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYNFMQKMLLPCGLPPEREDE 87          
BLAST of CF835903 vs. ExPASy Swiss-Prot
Match: SF3B5_DROME (Probable splicing factor 3B subunit 5 OS=Drosophila melanogaster GN=CG11985 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.044e-25
Identity = 51/83 (61.45%), Postives = 64/83 (77.11%), Query Frame = 3
Query:   15 DTFNINSPLQHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYFAIAENESIGRERYNFMHKMLLPCGLPPEREDD 263
            + +NI+S L+HLQ+KY+GTGHAD  +FEW  N  RDS ASY+GHY +L YFAIAENES  R R+N M +ML PCG PPE+ +D
Sbjct:    3 ERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVRFNLMERMLQPCGPPPEKLED 85          
BLAST of CF835903 vs. ExPASy Swiss-Prot
Match: SF3B5_HUMAN (Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF3B5 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.969e-24
Identity = 48/84 (57.14%), Postives = 64/84 (76.19%), Query Frame = 3
Query:   12 SDTFNINSPLQHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYFAIAENESIGRERYNFMHKMLLPCGLPPEREDD 263
            +D + I+S L+HLQ+KY+GTGHAD  ++EW VN  RDSY SY+GH+ +L YFAIAENES  R R+N M KML PCG P ++ ++
Sbjct:    2 TDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEE 85          
BLAST of CF835903 vs. ExPASy Swiss-Prot
Match: SF3B5_BOVIN (Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B5 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.969e-24
Identity = 48/84 (57.14%), Postives = 64/84 (76.19%), Query Frame = 3
Query:   12 SDTFNINSPLQHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYFAIAENESIGRERYNFMHKMLLPCGLPPEREDD 263
            +D + I+S L+HLQ+KY+GTGHAD  ++EW VN  RDSY SY+GH+ +L YFAIAENES  R R+N M KML PCG P ++ ++
Sbjct:    2 TDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEE 85          
BLAST of CF835903 vs. ExPASy Swiss-Prot
Match: SF3B5_MOUSE (Splicing factor 3B subunit 5 OS=Mus musculus GN=Sf3b5 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.843e-23
Identity = 47/84 (55.95%), Postives = 63/84 (75.00%), Query Frame = 3
Query:   12 SDTFNINSPLQHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYFAIAENESIGRERYNFMHKMLLPCGLPPEREDD 263
            +D + I+S L+HLQ+KY+GTGHAD  ++EW VN  RDSY SY+GH+ +L YFAIAENES  R R+N M KML P G P ++ ++
Sbjct:    2 TDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEE 85          
BLAST of CF835903 vs. ExPASy Swiss-Prot
Match: SF3B5_DICDI (Splicing factor 3B subunit 5 OS=Dictyostelium discoideum GN=sf3b5 PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.037e-21
Identity = 45/84 (53.57%), Postives = 63/84 (75.00%), Query Frame = 3
Query:   12 SDTFNINSPLQHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYFAIAENESIGRERYNFMHKMLLPCGLPPEREDD 263
            S+  ++NS L+HLQ +YVGTGHAD+++ EW  N  RDS +S+IGH   L+ F+IAENES+GR RYN + KM+ PCG  P+ +D+
Sbjct:    2 SERESLNSQLEHLQMRYVGTGHADISKHEWLTNQHRDSLSSFIGHSSFLSLFSIAENESVGRVRYNTLTKMISPCGPAPKIKDN 85          
BLAST of CF835903 vs. ExPASy Swiss-Prot
Match: YHV5_SCHPO (Uncharacterized protein C211.05 OS=Schizosaccharomyces pombe GN=SPBC211.05 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.115e-14
Identity = 35/79 (44.30%), Postives = 50/79 (63.29%), Query Frame = 3
Query:   12 SDTFNINSPLQHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYFAIAENESIGRERYNFMHKMLLPCGLPP 248
            +D     + L+ LQA+YVG G+A   ++EW VN  RD+ +S +GH P+LAY A A  E   + R N + KM++PCG PP
Sbjct:    2 ADRLRSQAKLEQLQARYVGVGNAFTTKYEWMVNQHRDTLSSVVGHPPLLAYMATALGEPRVQVRKNLLEKMIMPCGPPP 80          
The following BLAST results are available for this feature:
BLAST of CF835903 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
SF3BB_ARATH2.734e-4290.80Uncharacterized protein At4g14342 OS=Arabidopsis t... [more]
SF3BA_ARATH2.734e-4290.80Uncharacterized protein At3g23325 OS=Arabidopsis t... [more]
SF3B5_DROME1.044e-2561.45Probable splicing factor 3B subunit 5 OS=Drosophil... [more]
SF3B5_HUMAN1.969e-2457.14Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF... [more]
SF3B5_BOVIN1.969e-2457.14Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B... [more]
SF3B5_MOUSE2.843e-2355.95Splicing factor 3B subunit 5 OS=Mus musculus GN=Sf... [more]
SF3B5_DICDI2.037e-2153.57Splicing factor 3B subunit 5 OS=Dictyostelium disc... [more]
YHV5_SCHPO4.115e-1444.30Uncharacterized protein C211.05 OS=Schizosaccharom... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_02B12_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835903 ID=CF835903; Name=CF835903; organism=Citrus sinensis; type=EST; length=455bp
AAATGCAGGCGAGTGATACGTTTAATATAAACTCCCCCCTACAGCATCTG
CAAGCCAAATACGTTGGTACTGGCCATGCTGATTTGAACAGATTTGAATG
GGCTGTGAACATTCAGCGTGATAGCTATGCCTCGTATATTGGGCATTACC
CTATGTTGGCCTATTTTGCTATTGCCGAGAATGAATCTATTGGAAGGGAA
CGCTATAACTTTATGCATAAAATGCTTTTGCCTTGCGGCTTACCCCCTGA
AAGAGAAGATGATTGAGAGTTTAGGATGCCCTTTCTGAGAAATGAAACAT
TTTGGGCTCCAGCTCTCTCCAGGCTGAGGAGCATTTGTGATATATCTAGG
TGTTCACTTCAAGGAACAATGTTCATGTGACACTGACAAAACTGTGTAGC
AGGGTGTACTGAAATGAATGCTCGAGTGTTGTTGCAATCCTTGGAATTAT
ATAAA
back to top