CF835909

Overview
NameCF835909
Unique NameCF835909
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12605 contig Csv1_Contig12605:82..800. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC_MAIZE (Malate dehydrogenase, cytoplasmic OS=Zea mays PE=2 SV=2)

HSP 1 Score: 402.905 bits (1034), Expect = 8.797e-112
Identity = 201/214 (93.93%), Postives = 208/214 (97.20%), Query Frame = 3
Query:   78 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRELV 719
            MAKEP+RVLVTGAAGQIGYALVPMIARGVMLG DQPVILHMLDIPPAAEALNGVKMELVDAAFPL+KGVVATTD VEACTGVN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE HAAPNCKVLVVANPANTNALILKEFAPSIP KN+TCLTRLDHNRALGQISE+LNVQVSDVKNVIIWGNHSSSQYPDVNHATV T+ GEKPVRELV
Sbjct:    1 MAKEPMRVLVTGAAGQIGYALVPMIARGVMLGADQPVILHMLDIPPAAEALNGVKMELVDAAFPLLKGVVATTDVVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEAHAAPNCKVLVVANPANTNALILKEFAPSIPEKNVTCLTRLDHNRALGQISERLNVQVSDVKNVIIWGNHSSSQYPDVNHATVKTSTGEKPVRELV 214          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC2_ARATH (Malate dehydrogenase, cytoplasmic 2 OS=Arabidopsis thaliana GN=At5g43330 PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 8.234e-110
Identity = 198/214 (92.52%), Postives = 208/214 (97.20%), Query Frame = 3
Query:   78 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRELV 719
            MAKEPVRVLVTGAAGQIGYALVPMIARG+MLG DQPVILHMLDIP AAEALNGVKMELVDAAFPL+KGVVATTDAVEACTGVN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE+HAAPNCKVLVVANPANTNALILKEFAPSIP KNITCLTRLDHNRALGQ+SE+L+V VSDVKNVIIWGNHSS+QYPDVNHATV T+ GEKPVRELV
Sbjct:    1 MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPFAAEALNGVKMELVDAAFPLLKGVVATTDAVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQVSERLSVPVSDVKNVIIWGNHSSTQYPDVNHATVKTSVGEKPVRELV 214          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC_ORYSJ (Malate dehydrogenase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os10g0478200 PE=1 SV=3)

HSP 1 Score: 395.971 bits (1016), Expect = 1.075e-109
Identity = 196/214 (91.59%), Postives = 206/214 (96.26%), Query Frame = 3
Query:   78 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRELV 719
            MAKEP+RVLVTGAAGQIGYALVPMIARGVMLG DQPVILHMLDIPPA E+LNG+KMELVDAAFPL+KG+VATTD VEACTGVN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE HAAPNCKVLVVANPANTNALILKEFAPSIP KNITCLTRLDHNRALGQISEKLNVQV+DVKN IIWGNHSS+QYPDVNHATV T +GEKPVRELV
Sbjct:    1 MAKEPMRVLVTGAAGQIGYALVPMIARGVMLGADQPVILHMLDIPPATESLNGLKMELVDAAFPLLKGIVATTDVVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEAHAAPNCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISEKLNVQVTDVKNAIIWGNHSSTQYPDVNHATVKTPSGEKPVRELV 214          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC1_ARATH (Malate dehydrogenase, cytoplasmic 1 OS=Arabidopsis thaliana GN=At1g04410 PE=1 SV=2)

HSP 1 Score: 395.586 bits (1015), Expect = 1.405e-109
Identity = 196/214 (91.59%), Postives = 208/214 (97.20%), Query Frame = 3
Query:   78 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRELV 719
            MAKEPVRVLVTGAAGQIGYALVPMIARG+MLG DQPVILHMLDIPPAAEALNGVKMEL+DAAFPL+KGVVATTDAVE CTGVN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QA+ALE+HAAPNCKVLVVANPANTNALILKEFAPSIP KNI+CLTRLDHNRALGQISE+L+V VSDVKNVIIWGNHSSSQYPDVNHA V T++GEKPVRELV
Sbjct:    1 MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDAVEGCTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELV 214          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC_MEDSA (Malate dehydrogenase, cytoplasmic OS=Medicago sativa GN=CMDH PE=2 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 2.396e-109
Identity = 198/214 (92.52%), Postives = 208/214 (97.20%), Query Frame = 3
Query:   78 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRELV 719
            MAK+PVRVLVTGAAGQIGYALVPMIARGVMLG DQPVILHMLDI PAAE+LNGVKMELVDAAFPL+KGVVATTD VEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE+HAA NCKVLVVANPANTNALILKEFAPSIP +NI+CLTRLDHNRALGQISE+LNVQVSDVKNVIIWGNHSS+QYPDVNHATVNT AGEKPVR+LV
Sbjct:    1 MAKDPVRVLVTGAAGQIGYALVPMIARGVMLGPDQPVILHMLDIAPAAESLNGVKMELVDAAFPLLKGVVATTDVVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKHAAANCKVLVVANPANTNALILKEFAPSIPERNISCLTRLDHNRALGQISERLNVQVSDVKNVIIWGNHSSTQYPDVNHATVNTPAGEKPVRQLV 214          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC_MESCR (Malate dehydrogenase, cytoplasmic OS=Mesembryanthemum crystallinum GN=MDH PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 2.649e-108
Identity = 196/214 (91.59%), Postives = 205/214 (95.79%), Query Frame = 3
Query:   78 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRELV 719
            MA EP+RVLVTGAAGQIGYALVPMIARG+MLG +QPVILHMLDIPPAAEALNGVKMELVDAAFPL+KGVVATTDA EAC GVN+AVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIP KNI+CLTRLDHNRALGQISE+LNVQVSDVKNVIIWGNHSS+QYPDVNHATV T   +KPVRELV
Sbjct:    1 MAVEPLRVLVTGAAGQIGYALVPMIARGIMLGANQPVILHMLDIPPAAEALNGVKMELVDAAFPLLKGVVATTDAAEACKGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQISERLNVQVSDVKNVIIWGNHSSTQYPDVNHATVKTQGVDKPVRELV 214          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC_BETVU (Malate dehydrogenase, cytoplasmic OS=Beta vulgaris GN=NR1 PE=1 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.421e-106
Identity = 193/214 (90.19%), Postives = 201/214 (93.93%), Query Frame = 3
Query:   78 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRELV 719
            MA EP+RVLVTGAAGQIGYALVPMIARGVMLG +QPVILHMLDIPPAAEALNGVKMELVDAAFPL+KGVVATTD  EAC GVN+AVMVGGFPRKEGMERKDVM KNVSIYK+QASALEQ+AAPNCKVLVVANPANTNALILKEFAPSIP KNITCLTRLDHNRALGQISE+LN QVSDVKNVIIWGNHSSSQYPDVN  TV T +GEK VRELV
Sbjct:    1 MAVEPLRVLVTGAAGQIGYALVPMIARGVMLGANQPVILHMLDIPPAAEALNGVKMELVDAAFPLLKGVVATTDVAEACKGVNVAVMVGGFPRKEGMERKDVMPKNVSIYKSQASALEQYAAPNCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISERLNAQVSDVKNVIIWGNHSSSQYPDVNPCTVKTGSGEKAVRELV 214          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC_CHICK (Malate dehydrogenase, cytoplasmic OS=Gallus gallus GN=MDH1 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 8.350e-62
Identity = 119/211 (56.40%), Postives = 152/211 (72.04%), Query Frame = 3
Query:   87 EPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRELV 719
            EP+RVLVTGAAGQI Y+L+  IA+G + G +QP++L +LDI P    L GV MEL D A PL++ V+ T     A   ++IA++VG  PR+EGMERKD++  NV I+K+Q +AL+++A    KV+VV NPANTN LI  + APSIP +N +CLTRLDHNRA  QI+ KL V  +DVKNVIIWGNHSS+QYPDVNHA VN    E  V E +
Sbjct:    3 EPIRVLVTGAAGQIAYSLLYSIAKGDVFGKEQPLVLVLLDITPMMTVLEGVVMELQDCALPLLREVIPTDKEEVAFKDLDIAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKTVKVVVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTSNDVKNVIIWGNHSSTQYPDVNHAKVNVKGKEVGVYEAI 213          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC_XENTR (Malate dehydrogenase, cytoplasmic OS=Xenopus tropicalis GN=mdh1 PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.090e-61
Identity = 118/199 (59.30%), Postives = 149/199 (74.87%), Query Frame = 3
Query:   87 EPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVN 683
            EPV+VLVTGAAGQI Y+L+  IA+G + G DQP+IL +LDI P    L GV MEL D A PL+K V+AT     A   +++A++VG  PR+EGMERKD++  NV I+K+Q +AL +++  + KV+VV NPANTN L   + APSIP +N +CLTRLDHNRA GQI+ KLNV   DVKNVIIWGNHSS+QYPD +HATVN
Sbjct:    3 EPVKVLVTGAAGQIAYSLLYGIAKGDVFGKDQPLILVLLDITPMMTVLEGVVMELQDCALPLLKEVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALNKYSKKSVKVIVVGNPANTNCLTAMKSAPSIPKENFSCLTRLDHNRAKGQIALKLNVASDDVKNVIIWGNHSSTQYPDASHATVN 201          
BLAST of CF835909 vs. ExPASy Swiss-Prot
Match: MDHC_RAT (Malate dehydrogenase, cytoplasmic OS=Rattus norvegicus GN=Mdh1 PE=1 SV=3)

HSP 1 Score: 236.498 bits (602), Expect = 1.090e-61
Identity = 120/209 (57.42%), Postives = 149/209 (71.29%), Query Frame = 3
Query:   87 EPVRVLVTGAAGQIGYALVPMIARGVMLGTDQPVILHMLDIPPAAEALNGVKMELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPDVNHATVNTAAGEKPVRE 713
            EP+RVLVTGAAGQI Y+L+  I  G + G DQP+IL +LDI P    L+GV MEL D A PL++ V+AT     A   +++AV+VG  PR+EGMERKD++  NV I+K+Q +ALE++A  + KV+VV NPANTN L   + APSIP +N +CLTRLDHNRA  QI+ KL V   DVKNVIIWGNHSS+QYPDVNHA V     E  V E
Sbjct:    3 EPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYE 211          
The following BLAST results are available for this feature:
BLAST of CF835909 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 212
Match NameE-valueIdentityDescription
MDHC_MAIZE8.797e-11293.93Malate dehydrogenase, cytoplasmic OS=Zea mays PE=2... [more]
MDHC2_ARATH8.234e-11092.52Malate dehydrogenase, cytoplasmic 2 OS=Arabidopsis... [more]
MDHC_ORYSJ1.075e-10991.59Malate dehydrogenase, cytoplasmic OS=Oryza sativa ... [more]
MDHC1_ARATH1.405e-10991.59Malate dehydrogenase, cytoplasmic 1 OS=Arabidopsis... [more]
MDHC_MEDSA2.396e-10992.52Malate dehydrogenase, cytoplasmic OS=Medicago sati... [more]
MDHC_MESCR2.649e-10891.59Malate dehydrogenase, cytoplasmic OS=Mesembryanthe... [more]
MDHC_BETVU9.421e-10690.19Malate dehydrogenase, cytoplasmic OS=Beta vulgaris... [more]
MDHC_CHICK8.350e-6256.40Malate dehydrogenase, cytoplasmic OS=Gallus gallus... [more]
MDHC_XENTR1.090e-6159.30Malate dehydrogenase, cytoplasmic OS=Xenopus tropi... [more]
MDHC_RAT1.090e-6157.42Malate dehydrogenase, cytoplasmic OS=Rattus norveg... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_02B16_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02B16, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835909 ID=CF835909|Name=CF835909|organism=Citrus sinensis|type=EST|length=719bp
CTCCATCGAACCTCTCCTTCTCTCGCTTTACTGGAAAAATCTTTTCGTTT
CCCGTGATACATCTCTGATCCGAATTAATGGCCAAGGAACCAGTTCGCGT
TCTTGTCACCGGCGCCGCAGGGCAAATTGGATATGCACTTGTCCCCATGA
TTGCTAGGGGAGTGATGTTGGGTACTGACCAGCCTGTGATTCTGCACATG
CTTGATATACCACCTGCAGCAGAGGCATTGAATGGTGTGAAGATGGAGTT
GGTTGATGCTGCATTCCCTCTTATTAAAGGTGTTGTTGCTACAACTGATG
CTGTTGAGGCATGCACTGGGGTCAATATTGCCGTTATGGTTGGTGGCTTT
CCAAGAAAAGAAGGAATGGAGAGAAAAGATGTGATGTCAAAGAACGTTTC
AATCTACAAGGCTCAGGCTTCTGCCCTGGAGCAGCACGCAGCTCCGAACT
GCAAGGTTCTAGTTGTCGCTAACCCTGCAAACACCAATGCATTGATTCTG
AAAGAATTTGCGCCATCAATCCCTGCTAAGAACATTACATGCTTGACCAG
ATTGGATCATAACAGGGCATTGGGACAAATATCTGAGAAACTGAATGTCC
AAGTATCTGATGTTAAGAATGTGATTATTTGGGGAAATCATTCATCATCT
CAGTACCCTGATGTCAACCATGCAACTGTCAATACTGCAGCTGGGGAAAA
ACCTGTCCGTGAGCTTGTC
back to top