CF835922

Overview
NameCF835922
Unique NameCF835922
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length829
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7838 contig Csv1_Contig7838:796..1624. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA_PRUDU (Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 3.486e-113
Identity = 199/199 (100.00%), Postives = 199/199 (100.00%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA1_PEA (Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 3.486e-113
Identity = 199/199 (100.00%), Postives = 199/199 (100.00%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA1_ANEPH (Tubulin alpha-1 chain OS=Anemia phyllitidis GN=TUBA1 PE=2 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 7.766e-113
Identity = 198/199 (99.50%), Postives = 199/199 (100.00%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA4_GOSHI (Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 1.014e-112
Identity = 198/199 (99.50%), Postives = 198/199 (99.50%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA2_GOSHI (Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 1.325e-112
Identity = 197/199 (98.99%), Postives = 199/199 (100.00%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAF+HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA1_GOSHI (Tubulin alpha-1 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 2.951e-112
Identity = 197/199 (98.99%), Postives = 198/199 (99.50%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEF+TNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQF DWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFRTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA6_ARATH (Tubulin alpha-6 chain OS=Arabidopsis thaliana GN=TUBA6 PE=2 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 6.574e-112
Identity = 196/199 (98.49%), Postives = 198/199 (99.50%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA2_ARATH (Tubulin alpha-2/alpha-4 chain OS=Arabidopsis thaliana GN=TUBA2 PE=2 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 6.574e-112
Identity = 196/199 (98.49%), Postives = 198/199 (99.50%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA_OXYGR (Tubulin alpha chain OS=Oxytricha granulifera PE=3 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 8.586e-112
Identity = 195/199 (97.99%), Postives = 198/199 (99.50%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNST++AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
BLAST of CF835922 vs. ExPASy Swiss-Prot
Match: TBA_CHLVU (Tubulin alpha chain OS=Chlorella vulgaris GN=TUBA PE=3 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 8.586e-112
Identity = 194/199 (97.49%), Postives = 199/199 (100.00%), Query Frame = -3
Query:  231 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 827
            VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSY+PVISAEKAYHEQLSVAEITNSAFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct:  234 VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYSPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432          
The following BLAST results are available for this feature:
BLAST of CF835922 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 415
Match NameE-valueIdentityDescription
TBA_PRUDU3.486e-113100.00Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 ... [more]
TBA1_PEA3.486e-113100.00Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE... [more]
TBA1_ANEPH7.766e-11399.50Tubulin alpha-1 chain OS=Anemia phyllitidis GN=TUB... [more]
TBA4_GOSHI1.014e-11299.50Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA2_GOSHI1.325e-11298.99Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA1_GOSHI2.951e-11298.99Tubulin alpha-1 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA6_ARATH6.574e-11298.49Tubulin alpha-6 chain OS=Arabidopsis thaliana GN=T... [more]
TBA2_ARATH6.574e-11298.49Tubulin alpha-2/alpha-4 chain OS=Arabidopsis thali... [more]
TBA_OXYGR8.586e-11297.99Tubulin alpha chain OS=Oxytricha granulifera PE=3 ... [more]
TBA_CHLVU8.586e-11297.49Tubulin alpha chain OS=Chlorella vulgaris GN=TUBA ... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_02C03_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835922 ID=CF835922|Name=CF835922|organism=Citrus sinensis|type=EST|length=829bp
TTTTTTTTTTTTTTATAGAACCCAGAAACTTGATAAGCATAACAACTTTC
AACAAGCTTTGAAATTGAGCGAGAATCAAGAATAAGCTTTTCATCACAAA
ATAAAGGCACGAAGCATCACTAAAGCACAAGACATCATATTAAAACGCAC
AGATAATTTCACACTTAAATCCCTTAGTCCTCCTCACCATAATCTTCCTC
ACCCTCGGCAGACTCTGCACCCACCTCCTCATAATCCTTCTCAAGGGCAG
CAAGATCCTCACGAGCCTCAGAGAACTCTCCTTCTTCCATACCCTCGCCA
ACATACCAGTGGACGAAAGCACGCTTTGCATACATAAGATCAAACTTGTG
GTCAATGCGAGAGAACACCTCTGCCACACTGGTGGAGTTGGAGATCATGC
AAACAGCCCTCTGCACCTTGGCAAGGTCACCACCAGGAACAACAGTTGGT
GGCTGGTAGTTGATACCACACTTGAACCCAGTCGGGCACCAGTCGACGAA
TTGGATTGTACGCTTGGTCTTGATGGTAGCAACAGCTGCATTGACATCCT
TGGGCACAACATCACCGCGGTACATAAGGCAGCAAGCCATGTACTTGCCA
TGACGAGGATCACATTTGGCCATCATAGATGAGGGCTCAAAGGCACTGTT
GGTGATCTCAGCAACTGAGAGTTGTTCATGGTAGGCCTTCTCAGCTGAGA
TGACTGGTGCATAGGAGGAAAGCATGAAGTGGATTCTTGGGTATGGGACC
AAGTTGGTTTGGAATTCAGTCACATCCACATTCAAAGCACCATCAAACCT
CAGTGAGGCAGTCAATGAAGAAATTACCT
back to top