CF835927

Overview
NameCF835927
Unique NameCF835927
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length788
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10309 contig Csv1_Contig10309:73..860. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: FHIT_DICDI (Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.246e-32
Identity = 70/145 (48.28%), Postives = 95/145 (65.52%), Query Frame = -1
Query:  321 FGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEENDGNKDVKEKQKLDLDIQMKNRTMEEMAQEADEYRSLLSK 755
            FGP+ I   ++F++T LS+ALVNL+P+LPGHVLVCP+R   R  DLT +E  DLWL+AQ + + +E +     + FAIQDG  AGQTV HVHIHI+PRK   FE ND   +  EK++       + R+ EEM +E+ E R L  +
Sbjct:    6 FGPWLIRQSEIFFTTELSFALVNLKPVLPGHVLVCPKRIVPRVKDLTKEEFTDLWLSAQRISSVVEEHFNGDGITFAIQDGKNAGQTVEHVHIHIIPRKKFDFENNDQIYNEIEKER-------EPRSYEEMEKESSELRPLFEE 143          
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: FHIT_BOVIN (Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=FHIT PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.733e-32
Identity = 72/143 (50.35%), Postives = 92/143 (64.34%), Query Frame = -1
Query:  336 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEENDGNKDVKEK-QKLDLDIQMKNRTMEEMAQEADEYR 761
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF D++ +E  DL+  AQ VGT +E + + +SL F++QDGP+AGQTV HVH+HI+PRKA  F  ND   D  EK  + D D     R+ EEMA EA   R
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQAAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKAGDFHRNDSIYDALEKHDREDKDSPALWRSEEEMAAEAAALR 145          
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: FHIT_HUMAN (Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3)

HSP 1 Score: 135.576 bits (340), Expect = 3.068e-31
Identity = 70/142 (49.30%), Postives = 89/142 (62.68%), Query Frame = -1
Query:  336 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEENDGNKDVKEKQKLDLDIQMKNRTMEEMAQEADEYR 761
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF DL  DE  DL+ T Q VGT +E +   +SL F++QDGP+AGQTV HVH+H++PRKA  F  ND   +  +K   + D     R+ EEMA EA   R
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKE-DFPASWRSEEEMAAEAAALR 143          
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: FHIT_RAT (Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus GN=Fhit PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.597e-30
Identity = 68/144 (47.22%), Postives = 92/144 (63.89%), Query Frame = -1
Query:  333 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEENDGNKDVKEK-QKLDLDIQMKNRTMEEMAQEADEYRS 761
            + FG   I P  VF  T LS+ALVN +P++PGHVL+CP R   RF DL  DE  DL+   Q VGT +E + + +S+ F++QDGP+AGQTV HVH+HI+PRK+  F  ND   D  +K  + + D     R+ EEMA EA+  R+
Sbjct:    3 FKFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLMCPLRPVERFRDLRPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHILPRKSGDFRRNDNIYDELQKHDREEEDSPAFWRSEEEMAAEAEVLRA 146          
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: FHIT_MOUSE (Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN=Fhit PE=2 SV=3)

HSP 1 Score: 132.109 bits (331), Expect = 3.392e-30
Identity = 68/143 (47.55%), Postives = 91/143 (63.64%), Query Frame = -1
Query:  336 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEENDGNKDVKEK-QKLDLDIQMKNRTMEEMAQEADEYR 761
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF DL  DE  DL+   Q VGT +E + + +S+ F++QDGP+AGQTV HVH+H++PRKA  F  ND   D  +K  + + D     R+ +EMA EA+  R
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALR 145          
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: NFT1_CAEEL (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 8.355e-29
Identity = 67/152 (44.08%), Postives = 91/152 (59.87%), Query Frame = -1
Query:  327 KMSSIEQYAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEENDGNKDVKEKQKLDLDIQMKNRTMEEMAQEADEYRSLL 782
            K S      F  F I    +FYSTP S+  VNL+P+  GHVLV P+R   R  DLT  ET DL++ A+ V   LE +H  +S    +QDG  AGQTVPHVHIHI+PR+A  F +N+  + +    K   + + K R+ E+MA+EA  YR+L+
Sbjct:  292 KSSETGGLKFARFNIPADHIFYSTPHSFVFVNLKPVTDGHVLVSPKRVVPRLTDLTDAETADLFIVAKKVQAMLEKHHNVTSTTICVQDGKDAGQTVPHVHIHILPRRAGDFGDNEIYQKLASHDK---EPERKPRSNEQMAEEAVVYRNLM 440          
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: APH1_SCHPO (Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe GN=aph1 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 4.291e-25
Identity = 71/176 (40.34%), Postives = 90/176 (51.14%), Query Frame = -1
Query:  321 EQYAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEEND-------------------GNK--------DVKEKQKLDLDIQMKNRTMEEMAQEADEYRSLLSK 767
            +Q  F  F +   QVFY T LS A VNL+P+LPGHVLV P+R   R  DLT  E  DL+ + + V   +E    AS+    IQDG  AGQTVPHVH+HI+PRK A F END                   GN+            +Q +  D   K RT+EEM +EA   +   S+
Sbjct:    3 KQLYFSKFPVGS-QVFYRTKLSAAFVNLKPILPGHVLVIPQRAVPRLKDLTPSELTDLFTSVRKVQQVIEKVFSASASNIGIQDGVDAGQTVPHVHVHIIPRKKADFSENDLVYSELEKNEGNLASLYLTGNERYAGDERPPTSMRQAIPKDEDRKPRTLEEMEKEAQWLKGYFSE 177          
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: HNT2_YEAST (Hit family protein 2 OS=Saccharomyces cerevisiae GN=HNT2 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 4.156e-20
Identity = 55/131 (41.98%), Postives = 80/131 (61.07%), Query Frame = -1
Query:  339 QVFYSTPLSYALVNLRPLLPGHVLVCPRRDAV-RFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEENDGNKDVKEKQKLDLDIQMKNRTMEEMAQEADEY 728
            QVFY +  +YALVNL+P++PGHVL+ P R  V    DLT  E++D + T Q +   ++  +KA S+  AIQDGP+AGQ+VPH+H HI+PR    ++ N+    + +K    LD    N T+ +     DEY
Sbjct:   15 QVFYKSKYTYALVNLKPIVPGHVLIVPLRTTVLNLSDLTMPESQDYFKTLQLIHRFIKWQYKADSINVAIQDGPEAGQSVPHLHTHIIPR----YKINNVGDLIYDK----LDHWDGNGTLTDWQGRRDEY 137          
BLAST of CF835927 vs. ExPASy Swiss-Prot
Match: NFT1_DROME (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster GN=NitFhit PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.579e-19
Identity = 57/142 (40.14%), Postives = 77/142 (54.23%), Query Frame = -1
Query:  318 IDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQTVPHVHIHIVPRKAASFEENDGNKDVKEKQKLDLDIQMK-NRTMEEMAQEADEYRSLLSKI 740
            +D R +FY +   +A  NLR ++ GHVLV  +R   R   L   E  D++ T   V   LE  ++ +S    +QDG QAGQTVPHVH HI+PR+   F  ND     +   KLD   + K  RT+EE  +EA  YR  L+ I
Sbjct:  323 VDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSATVTVQDGAQAGQTVPHVHFHIMPRRLGDFGHND-----QIYVKLDERAEEKPPRTIEERIEEAQIYRKFLTDI 459          
The following BLAST results are available for this feature:
BLAST of CF835927 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
FHIT_DICDI1.246e-3248.28Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium d... [more]
FHIT_BOVIN4.733e-3250.35Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=F... [more]
FHIT_HUMAN3.068e-3149.30Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN... [more]
FHIT_RAT2.597e-3047.22Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegic... [more]
FHIT_MOUSE3.392e-3047.55Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN... [more]
NFT1_CAEEL8.355e-2944.08Nitrilase and fragile histidine triad fusion prote... [more]
APH1_SCHPO4.291e-2540.34Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] ... [more]
HNT2_YEAST4.156e-2041.98Hit family protein 2 OS=Saccharomyces cerevisiae G... [more]
NFT1_DROME1.579e-1940.14Nitrilase and fragile histidine triad fusion prote... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_02C06_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835927 ID=CF835927|Name=CF835927|organism=Citrus sinensis|type=EST|length=788bp
TTTTTTATTCAACATTTATCATGACATTAGTAACCAATGTAGCTCAAAAC
TAAATACAACACACTTAGATTGATACTATACATGCATAATAAACTTAGAA
TTTCAGGAATTCCAGCGCAACAAGAGGACGAGTGAAGGATTATTCTGCAT
AGGTATGATGTATAATAATTCTATGAAAGCCCCAATGCTTAGCGTAAGTA
TTATAAATGTTTATAAACTTCCATGAAGTATTATTGAAGGGCAGTTTCTT
AAATCTCAAACGCATTGGAGGCAGCTTTGATGAAAGCTTGAGAAAAGCTT
AGCGAAAGGCAGTGTTAAATTTTTGACAAAAGCGACCTGTACTCATCAGC
CTCTTGAGCCATCTCCTCCATGGTCCTGTTCTTCATTTGAATATCTAAAT
CAAGCTTCTGCTTCTCCTTCACATCTTTATTCCCATCATTTTCCTCAAAG
CTGGCAGCTTTGCGTGGGACAATATGGATGTGAACATGGGGCACTGTCTG
TCCAGCTTGAGGTCCATCTTGAATGGCAAATGCTAGTGATGAAGCCTTGT
GGTAGCTTTCGAGCTGTGTGCCAACTGTCTGGGCCGTGAGCCATAAATCA
CGGGTCTCATCAGCAGTAAGATCACCAAAGCGAACCGCGTCACGCCTTGG
GCAGACAAGCACATGACCAGGAAGCAGAGGGCGCAAGTTGACCAAGGCGT
AGGATAGAGGGGTTGAATAGAACACTTGCCTAGGATCTATCTTAAAAGGG
CCGAACGCATATTGCTCGATGGATGACATCTTTGGCGA
back to top