CF835930

Overview
NameCF835930
Unique NameCF835930
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length759
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10620 contig Csv1_Contig10620:20..778. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: MOMAS_ORYSJ (Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 6.443e-31
Identity = 76/190 (40.00%), Postives = 106/190 (55.79%), Query Frame = 3
Query:  135 RLQGRVXXXXXXXXXXXXXXXQLFHKNGAKVVIADVQDNLGQALADKLGNQDVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTGTGTTACAEIEGFCNIPANYYGVSKFGILGLVKGLAAELGRYGIRVDCVS 704
            +L G+V               +LF K+GA+VV+AD+QD LG +L  +LG     Y+HCDV+NE +V   VD  VA+FGKLD++ N    +       + +  K D E +LAVN +G FL  KHAARVM P RRG I+ T    ++            ++ Y  SK  ++G  +  A ELGR+GIRV+CVS
Sbjct:   14 KLVGKVAVITGGASGIGACTARLFVKHGARVVVADIQDELGASLVAELGPDASSYVHCDVTNEGDVAAAVDHAVARFGKLDVMFN-NAGVSGPPCFRMSECTKEDFERVLAVNLVGPFLGTKHAARVMAPARRGSIISTASLSSSV-------SGAASHAYTTSKHALVGFTENAAGELGRHGIRVNCVS 195          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: ABA2_ARATH (Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.537e-24
Identity = 81/210 (38.57%), Postives = 109/210 (51.90%), Query Frame = 3
Query:  129 SIRLQGRVXXXXXXXXXXXXXXXQLFHKNGAKVVIADVQDNLGQALADKL----GNQDVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTGTGTTACAEIEGFCNIPANYYGVSKFGILGLVKGLAAELGRYGIRVDCVSHTYGLAMTEAIASI 746
            S RL G+V               +LFHK+GAKV I D+QD+LG  +   L      +   +IH DV  E ++ N VD  V  FG LDIL+N    L       I +   S+ E    VN  G FL  KHAARVM+P ++G I+     G      + G    P +Y G SK  +LGL + +AAELG++GIRV+CVS  Y +A   A+A +
Sbjct:   15 SQRLLGKVALITGGATGIGESIVRLFHKHGAKVCIVDLQDDLGGEVCKSLLRGESKETAFFIHGDVRVEDDISNAVDFAVKNFGTLDILINNA-GLCGAPCPDIRNYSLSEFEMTFDVNVKGAFLSMKHAARVMIPEKKGSIVSLCSVGGV----VGGVG--PHSYVG-SKHAVLGLTRSVAAELGQHGIRVNCVS-PYAVATKLALAHL 215          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: TS2_MAIZE (Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.699e-23
Identity = 76/199 (38.19%), Postives = 107/199 (53.77%), Query Frame = 3
Query:  135 RLQGRVXXXXXXXXXXXXXXXQLFHKNGAKVVIADVQDNLGQALADKLGNQDVCYIHCDVSNEREVINLVDTTVAKF-GKLDILVNTGCNL--EYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTGTGTTACAEIEGFCNIPANYYGVSKFGILGLVKGLAAELGRYGIRVDCVSHTYGLA 722
            RL G+V               +LF K+GA+VVIAD+ D  G+ALA  LG Q V ++ CDVS E +V   VD  +++  G+LD+  N    L  + R   SIL    ++ + +L VN +G  L  KHAAR M PRR G I+        + A + G   +  + Y  SK  I+GL K  A EL  +G+RV+CVS  +G+A
Sbjct:   52 RLDGKVAIVTGGARGIGEAIVRLFAKHGARVVIADIDDAAGEALASALGPQ-VSFVRCDVSVEDDVRRAVDWALSRHGGRLDVYCNNAGVLGRQTRAARSILSFDAAEFDRVLRVNALGAALGMKHAARAMAPRRAGSIV-----SVASVAAVLG--GLGPHAYTASKHAIVGLTKNAACELRAHGVRVNCVS-PFGVA 241          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: BACC2_BACSU (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus subtilis GN=bacC PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.295e-17
Identity = 55/168 (32.74%), Postives = 89/168 (52.98%), Query Frame = 3
Query:  198 QLFHKNGAKVVIADVQDNLGQALADKLGNQDVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTGTGTTACAEIEGFCNIPANYYGVSKFGILGLVKGLAAELGRYGIRVDCV 701
            Q F    A VV+AD+ +  G+A+  K  N  + ++H D+++E    N + + V KFG LD+L+N   N        I +   S+   +L VN  G FL++KHA + M+   +G I+ T   G      +  + +IPA  Y  SK G+L L + +A +  ++ IRV+CV
Sbjct:   23 QAFLNQQANVVVADIDEAQGEAMIRKENNDRLHFVHTDITDEPACQNAIRSAVDKFGGLDVLIN---NAGIEIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSVG-----GVVAWPDIPA--YNASKGGVLQLTRSMAVDYAKHNIRVNCV 180          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: Y019_THEMA (Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima GN=TM_0019 PE=3 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 3.432e-16
Identity = 59/192 (30.73%), Postives = 92/192 (47.92%), Query Frame = 3
Query:  138 LQGRVXXXXXXXXXXXXXXXQLFHKNGAKVVIADVQDNLGQALADKLGNQ--DVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTGTGTTACAEIEGFCNIP-ANYYGVSKFGILGLVKGLAAELGRYGIRVDCVS 704
            L+G+V               QLF +NG KVVIA++ +  G    + L  +  DV ++  DV++E  V N+V  TV  +G +D+LVN    +  +   SI + P  + E ++ VN  G ++ +++ A  M+ R  G I+    T          F + P    Y  SK G++ L   LA  L RY IRV  +S
Sbjct:    2 LEGKVAVVTGGGQGIGAAIAQLFAENGMKVVIAEIDEEAGVEREEMLRERGLDVTFVKTDVADENSVKNMVRKTVEIYGGVDVLVNNAAVMSVK---SIFERPLEEWERVIRVNLTGPYICSRYCAEEMIKRGGGVIINIAST--------RAFQSEPDTEPYSASKGGLVALTHSLAVSLSRYHIRVVSIS 182          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: BACC_BACSU (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus subtilis GN=bacC PE=3 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 7.646e-16
Identity = 55/168 (32.74%), Postives = 88/168 (52.38%), Query Frame = 3
Query:  198 QLFHKNGAKVVIADVQDNLGQALADKLGNQDVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTGTGTTACAEIEGFCNIPANYYGVSKFGILGLVKGLAAELGRYGIRVDCV 701
            Q F    A VV+AD+ +  G+A+  K  N  + ++  D+++E    + V++ V  FG LD+L+N   N        I +   SD   +L VN  G FL++KHA + M+   +G I+ T   G      +  + +IPA  Y  SK G+L L K +A +  ++ IRV+CV
Sbjct:   23 QAFLGQQANVVVADIDEAQGEAMVRKENNDRLHFVQTDITDEAACQHAVESAVHTFGGLDVLIN---NAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSVG-----GLVAWPDIPA--YNASKGGVLQLTKSMAVDYAKHQIRVNCV 180          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: Y325_THEMA (Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima GN=TM_0325 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.196e-14
Identity = 60/193 (31.09%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  132 IRLQGRVXXXXXXXXXXXXXXXQLFHKNGAKVVIADVQDNLGQALADKLGNQ--DVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTGTGTTACAEIEGFCNIPAN-YYGVSKFGILGLVKGLAAELGRYGIRVDCV 701
            +  QG+V                +F + GAKV I D+ +  G+   + + +   +  +I  DV+ + E I  V  TV  FG+LDILVN    + Y    +I +T + D +  +AVN  G FL++K+A   M  +  G I+  +           G   IP    Y VSK  +LGL + LA +   YGIRV+ V
Sbjct:    1 MNFQGKVVLITGAGSGIGKKAAVMFAERGAKVAINDISEEKGKETVELIKSMGGEAAFIFGDVAKDAEQI--VKKTVETFGRLDILVNNAGIVPYG---NIEETSEEDFDKTMAVNVKGPFLLSKYAVEQMKKQGGGVIVNVSSEA--------GLIGIPRRCVYSVSKAALLGLTRSLAVDYVDYGIRVNAV 180          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: HSD_MYCTU (3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis GN=fabG3 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.639e-13
Identity = 61/196 (31.12%), Postives = 87/196 (44.39%), Query Frame = 3
Query:  126 LSIRLQGRVXXXXXXXXXXXXXXXQLFHKNGAKVVIADVQDNLGQALADKLGNQDVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTG----TGTTACAEIEGFCNIPANYYGVSKFGILGLVKGLAAELGRYGIRVDCV 701
            +S RL G+V               +     GAKVV  D+ D  G+A+A +L +    Y+H DV+   +    VDT V  FG L +LVN   N       +I D   ++ + +L VN  G FL  +   + M    RG I+  +      GT AC           + Y  +KF + GL K  A ELG  GIRV+ +
Sbjct:    1 MSGRLIGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAVAAELADA-ARYVHLDVTQPAQWTAAVDTAVTAFGGLHVLVN---NAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVAC-----------HGYTATKFAVRGLTKSTALELGPSGIRVNSI 181          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: HSD_MYCBO (3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis GN=fabG3 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.639e-13
Identity = 61/196 (31.12%), Postives = 87/196 (44.39%), Query Frame = 3
Query:  126 LSIRLQGRVXXXXXXXXXXXXXXXQLFHKNGAKVVIADVQDNLGQALADKLGNQDVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTG----TGTTACAEIEGFCNIPANYYGVSKFGILGLVKGLAAELGRYGIRVDCV 701
            +S RL G+V               +     GAKVV  D+ D  G+A+A +L +    Y+H DV+   +    VDT V  FG L +LVN   N       +I D   ++ + +L VN  G FL  +   + M    RG I+  +      GT AC           + Y  +KF + GL K  A ELG  GIRV+ +
Sbjct:    1 MSGRLIGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAVAAELADA-ARYVHLDVTQPAQWTAAVDTAVTAFGGLHVLVN---NAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVAC-----------HGYTATKFAVRGLTKSTALELGPSGIRVNSI 181          
BLAST of CF835930 vs. ExPASy Swiss-Prot
Match: BACC_BACAM (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus amyloliquefaciens GN=bacC PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.639e-13
Identity = 54/169 (31.95%), Postives = 84/169 (49.70%), Query Frame = 3
Query:  198 QLFHKNGAKVVIADVQDNLGQALADKLGNQDVCYIHCDVSNEREVINLVDTTVAKFGKLDILVNTGCNLEYRGFVSILDTPKSDLEHLLAVNTIGGFLVAKHAARVMVPRRRGCILYTTGTGTTACAEIEGFCNIPANYYGVSKFGILGLVKGLAAE-LGRYGIRVDCV 701
            Q F    A VV+AD+ +  G+A+  K  N  + ++  D++NE    N + + V KFG LD+L+N   N        I +   SD   +L VN  G FL++KHA + M+   +G I+ T   G      +  + +IPA  Y  SK G+L          + ++ IRV+CV
Sbjct:   23 QAFLNQQANVVVADIDEAQGEAMIRKENNDRLHFVQTDITNEPACQNAILSAVDKFGGLDVLIN---NAGIEIVAPIHEMELSDWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSVG-----GVVAWPDIPA--YNASKGGVLQTDAFYRPSIIAKHNIRVNCV 181          
The following BLAST results are available for this feature:
BLAST of CF835930 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
MOMAS_ORYSJ6.443e-3140.00Momilactone A synthase OS=Oryza sativa subsp. japo... [more]
ABA2_ARATH1.537e-2438.57Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN... [more]
TS2_MAIZE1.699e-2338.19Sex determination protein tasselseed-2 OS=Zea mays... [more]
BACC2_BACSU5.295e-1732.74Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
Y019_THEMA3.432e-1630.73Uncharacterized oxidoreductase TM_0019 OS=Thermoto... [more]
BACC_BACSU7.646e-1632.74Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
Y325_THEMA4.196e-1431.09Uncharacterized oxidoreductase TM_0325 OS=Thermoto... [more]
HSD_MYCTU4.639e-1331.123-alpha-(or 20-beta)-hydroxysteroid dehydrogenase ... [more]
HSD_MYCBO4.639e-1331.123-alpha-(or 20-beta)-hydroxysteroid dehydrogenase ... [more]
BACC_BACAM4.639e-1331.95Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_02C07_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835930 ID=CF835930|Name=CF835930|organism=Citrus sinensis|type=EST|length=759bp
GAGGGATAATAATCACAAGCCAAACCTTGTATTTTAACAATCTTGATTGA
GTTTCAGGTTTTTGAGGAAATTTTTTCACACAGGCTTGTAGTACTACTGC
AGCAGCACCCTGCGAAAGGTGTCAACTCAGCATTCGGTTACAAGGCAGAG
TGGCAATCATTACTGGCGGAGCAAGCGGGATCGGAGCATCTGCGGCTCAG
CTTTTCCACAAAAATGGAGCCAAAGTTGTCATAGCCGATGTGCAAGATAA
TCTTGGCCAAGCCCTAGCCGATAAGCTAGGCAACCAGGATGTCTGCTACA
TCCATTGTGATGTATCAAATGAAAGGGAAGTCATCAATCTTGTTGATACC
ACCGTTGCTAAATTCGGAAAGCTCGACATCCTGGTCAATACCGGATGCAA
TCTTGAGTATCGTGGTTTCGTGAGCATTTTGGACACCCCAAAGTCTGATC
TAGAACATTTACTGGCTGTGAACACAATTGGTGGTTTCTTAGTAGCCAAG
CATGCTGCAAGAGTCATGGTGCCACGCCGCAGAGGTTGCATATTGTATAC
AACGGGTACGGGCACTACTGCTTGTGCGGAAATTGAAGGTTTCTGCAATA
TTCCAGCTAATTATTATGGAGTGTCAAAATTTGGTATCTTGGGACTTGTC
AAGGGCTTAGCGGCAGAGCTTGGACGGTATGGAATAAGAGTAGATTGCGT
ATCGCATACTTATGGCTTGGCAATGACTGAAGCGATAGCATCAATAGCAA
ACGCTGCGC
back to top