CF835977
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF835977 vs. ExPASy Swiss-Prot
Match: UCRIA_PEA (Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Pisum sativum GN=petC PE=2 SV=1) HSP 1 Score: 90.5077 bits (223), Expect = 2.793e-18 Identity = 45/71 (63.38%), Postives = 50/71 (70.42%), Query Frame = 3 Query: 9 LSAATPSQLCSSKSGMFCPSRAFLVKPSRTHMVTNNPMGMKIKCHATSIPGDTVPDMGKRQLMNWLLLSAV 221 LS TPSQLCS KSG+ CPS A LVKP+RT M GMKI C ATSIP D VPDM KR+ +N LLL A+ Sbjct: 6 LSPTTPSQLCSGKSGISCPSIALLVKPTRTQMTGRGNKGMKITCQATSIPADRVPDMSKRKTLNLLLLGAL 76
BLAST of CF835977 vs. ExPASy Swiss-Prot
Match: UCRIA_SPIOL (Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Spinacia oleracea GN=petC PE=1 SV=2) HSP 1 Score: 77.7962 bits (190), Expect = 1.873e-14 Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3 Query: 9 LSAATPSQLCSSKSGMFCPSRAFLVKPSRTHMVTNNPM--GMKIKCHATSIPGDTVPDMGKRQLMNWLLLSAV 221 LS+ATPSQLCSSK+GMF PS A L K R +++ + GMK+ C ATSIP D VPDM KR+ +N LLL A+ Sbjct: 6 LSSATPSQLCSSKNGMFAPSLA-LAKAGRVNVLISKERIRGMKLTCQATSIPADNVPDMQKRETLNLLLLGAL 77
BLAST of CF835977 vs. ExPASy Swiss-Prot
Match: UCRIA_FRIAG (Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Fritillaria agrestis GN=petC PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.290e-12 Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 3 Query: 21 TPSQLCSSKSGMFCPSRAFLVKPSRTHMVTNNPMGMKIKCHATSIPGDTVPDMGKRQLMNWLLLSAV 221 TPSQL ++K+G + PSRA L K +R + K+ C ATSIP D VPDMGKRQ MN LLL A+ Sbjct: 11 TPSQLSAAKNGAYSPSRALLGKTARGLYPEKEMVSRKVTCQATSIPADRVPDMGKRQTMNLLLLGAL 77
BLAST of CF835977 vs. ExPASy Swiss-Prot
Match: UCRIA_SOLTU (Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Solanum tuberosum GN=petC PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.663e-12 Identity = 44/78 (56.41%), Postives = 50/78 (64.10%), Query Frame = 3 Query: 3 SYLSAATPSQLCSSKSGMFCPSRAFLVKPSRTHMVTNNPMG----MKIKCHATSIPG-DTVPDMGKRQLMNWLLLSAV 221 S LS TPSQLCSSKSG+ S+A LVKP + + + MG MK KC A SIP D VPDM KR LMN LLL A+ Sbjct: 4 STLSHVTPSQLCSSKSGVSSVSQALLVKPMK---INGHGMGKDKRMKAKCMAASIPADDRVPDMEKRNLMNLLLLGAL 78 The following BLAST results are available for this feature:
BLAST of CF835977 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF835977 ID=CF835977; Name=CF835977; organism=Citrus sinensis; type=EST; length=223bpback to top |