CF836046

Overview
NameCF836046
Unique NameCF836046
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length752
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF5_XENTR (Protein YIPF5 OS=Xenopus tropicalis GN=yipf5 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.729e-28
Identity = 64/178 (35.96%), Postives = 117/178 (65.73%), Query Frame = -3
Query:  211 ASFDDEEPLLDELGIHPDQIWKKTKSILNPFRV-NPTVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVS-LADGGEEHRGLIAYACFLIYTLFSLLVIF 738
            ++FDDE PLL+ELGI+ D IW+KT ++L+P +V +  +   +DL+GP+V  L+FG   LLAGK+QFG + G   +  + +Y + N+++     +     +SV+GYC+LP++IL++F++     G +   ++A+ + W + +++ + +S LA  G++   L+AY C L+Y +F+L+ +F
Sbjct:   83 STFDDEPPLLEELGINFDHIWQKTLTVLHPLKVADGNIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMYCLLNLMS--MTGVSFGCVSSVLGYCLLPMIILSSFAVIFSLQGILGIVLAALIIGWCSFSASKIFISALAMDGQQ--VLVAYPCALLYGVFALISVF 256          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF7_HUMAN (Protein YIPF7 OS=Homo sapiens GN=YIPF7 PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 2.258e-28
Identity = 65/176 (36.93%), Postives = 110/176 (62.50%), Query Frame = -3
Query:  211 SFDDEEPLLDELGIHPDQIWKKTKSILNPFR-VNPTVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVSLADGGEEHRGLIAYACFLIYTLFSLLVIF 735
            SFD+E PLL+ELGIH D IW+KT ++LNP + V+ ++   +DL+GPI+  ++ G   LLAGK+QFG + G   +  + ++ + N+++  +  +      SV+GYC+LP+VIL+  ++F    G      S V + W + +++ + ++ A   E  + L+AY C ++Y LF+LL IF
Sbjct:  108 SFDEEPPLLEELGIHFDHIWQKTLTVLNPMKPVDGSIMNETDLTGPILFCVALGATLLLAGKVQFGYVYGMSAIGCLVIHALLNLMS--SSGVSYGCVASVLGYCLLPMVILSGCAMFFSLQGIFGIMSSLVIIGWCSLSASKIFIA-ALHMEGQQLLVAYPCAILYGLFALLTIF 280          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF5_XENLA (Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.950e-28
Identity = 64/178 (35.96%), Postives = 117/178 (65.73%), Query Frame = -3
Query:  211 ASFDDEEPLLDELGIHPDQIWKKTKSILNPFRV-NPTVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVS-LADGGEEHRGLIAYACFLIYTLFSLLVIF 738
            ++FDDE PLL+ELGI+ D IW+KT ++L+P +V + ++   +DL+GP+V  L+FG   LLAGK+QFG + G   +  + +Y + N+++     +     +SV+GYC+LP++IL+ F++     G +   ++A+ + W + +++ + +S LA  G++   L+AY C L+Y +F+L+ +F
Sbjct:   83 STFDDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAMGCLGMYCLLNLMS--MTGVSFGCVSSVLGYCLLPMIILSTFAVIFSLQGILGIVLAALIIGWCSFSASKIFISALAMDGQQL--LVAYPCALLYGVFALISVF 256          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF5_DANRE (Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.121e-27
Identity = 63/179 (35.20%), Postives = 114/179 (63.69%), Query Frame = -3
Query:  211 SASFDDEEPLLDELGIHPDQIWKKTKSILNPFRVNP-TVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVS-LADGGEEHRGLIAYACFLIYTLFSLLVIF 741
            S+SF+DE PLL+ELGI+ D IW+KT ++L+P + +  ++   +DL+GP+V  L+FG   LL GK+QFG + G   +  + +Y + N+++     +      SV+GYC+LP++IL++F +     G +   ++A  + W + +++ + +S LA  G++   L+AY C L+Y +F+L+ +F
Sbjct:   83 SSSFEDEPPLLEELGINFDHIWQKTLTVLHPLKASDGSIMNETDLAGPMVFCLAFGATLLLTGKIQFGYVYGISAIGCLGMYCLLNLMS--MTGVSFGCVASVLGYCLLPMIILSSFGVIFSLQGIMGIILTAAIIGWCSLSASKIFISALAMDGQQL--LVAYPCALLYGVFALISVF 257          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF7_MOUSE (Protein YIPF7 OS=Mus musculus GN=Yipf7 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.259e-27
Identity = 61/176 (34.66%), Postives = 110/176 (62.50%), Query Frame = -3
Query:  211 SFDDEEPLLDELGIHPDQIWKKTKSILNPFR-VNPTVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVSLADGGEEHRGLIAYACFLIYTLFSLLVIF 735
            +FD+E PLL+ELGI+ D IW+KT ++LNP +  + ++   +DL+GPI+  ++ G   L+AGK QFG + G   +  + ++ + N+++  N  +      SV+GYC+LP+V+L++ ++F    G I    + + + W + +++ + +S A   E  + L+AY C L+Y LF+LL +F
Sbjct:   82 TFDEEPPLLEELGINFDHIWQKTLTVLNPMKPADGSIMNETDLTGPILFCVALGATLLMAGKAQFGYVYGMSAIGCLGIHALLNLMS--NSGVSYGCVASVLGYCLLPMVLLSSCAVFFSLQGTIGTMSALLIITWCSLSASKIFIS-ALAMEGQQLLVAYPCALLYGLFALLTVF 254          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF5_RAT (Protein YIPF5 OS=Rattus norvegicus GN=Yipf5 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.259e-27
Identity = 61/177 (34.46%), Postives = 114/177 (64.41%), Query Frame = -3
Query:  211 SFDDEEPLLDELGIHPDQIWKKTKSILNPFRVNP-TVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVS-LADGGEEHRGLIAYACFLIYTLFSLLVIF 735
            SF++E PLL+ELGI+ D IW+KT ++L+P R +  ++   +DL+GP+V  L+FG   LLAGK+QFG + G   +  + ++ + N+++     +      SV+GYC+LP+++L++F++     G +   ++A  + W + +++ + +S LA  G++   L+AY C L+Y +F+L+ +F
Sbjct:   85 SFEEEPPLLEELGINFDHIWQKTLTVLHPLRASDGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMS--MTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFSASKIFISALAMDGQQL--LVAYPCALLYGVFALISVF 257          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF5_MOUSE (Protein YIPF5 OS=Mus musculus GN=Yipf5 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.563e-27
Identity = 61/177 (34.46%), Postives = 114/177 (64.41%), Query Frame = -3
Query:  211 SFDDEEPLLDELGIHPDQIWKKTKSILNPFRV-NPTVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVS-LADGGEEHRGLIAYACFLIYTLFSLLVIF 735
            SF++E PLL+ELGI+ D IW+KT ++L+P R  + ++   +DL+GP+V  L+FG   LLAGK+QFG + G   +  + ++ + N+++     +      SV+GYC+LP+++L++F++     G +   ++A  + W + +++ + +S LA  G++   L+AY C L+Y +F+L+ +F
Sbjct:   85 SFEEEPPLLEELGINFDHIWQKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMS--MTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFSASKIFISALAMDGQQL--LVAYPCALLYGVFALISVF 257          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF5_MACFA (Protein YIPF5 OS=Macaca fascicularis GN=YIPF5 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.563e-27
Identity = 61/176 (34.66%), Postives = 113/176 (64.20%), Query Frame = -3
Query:  211 SFDDEEPLLDELGIHPDQIWKKTKSILNPFRV-NPTVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVSLADGGEEHRGLIAYACFLIYTLFSLLVIF 735
            SF+DE PLL+ELGI+ D IW+KT ++L+P +V + ++   +DL+GP+V  L+FG   LLAGK+QFG + G   +  + ++ + N+++     +      SV+GYC+LP+++L++F++     G +   ++A  + W + +++ + +S A   E  + L+AY C L+Y +F+L+ +F
Sbjct:   85 SFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMS--MTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFIS-ALAMEGQQLLVAYPCALLYGVFALISVF 257          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF5_PONAB (Protein YIPF5 OS=Pongo abelii GN=YIPF5 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.239e-26
Identity = 60/176 (34.09%), Postives = 113/176 (64.20%), Query Frame = -3
Query:  211 SFDDEEPLLDELGIHPDQIWKKTKSILNPFRV-NPTVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVSLADGGEEHRGLIAYACFLIYTLFSLLVIF 735
            +F+DE PLL+ELGI+ D IW+KT ++L+P +V + ++   +DL+GP+V  L+FG   LLAGK+QFG + G   +  + ++ + N+++     +      SV+GYC+LP+++L++F++     G +   ++A  + W + +++ + +S A   E  + L+AY C L+Y +F+L+ +F
Sbjct:   85 NFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMS--MTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFIS-ALAMEGQQLLVAYPCALLYGVFALISVF 257          
BLAST of CF836046 vs. ExPASy Swiss-Prot
Match: YIPF5_HUMAN (Protein YIPF5 OS=Homo sapiens GN=YIPF5 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.239e-26
Identity = 60/176 (34.09%), Postives = 113/176 (64.20%), Query Frame = -3
Query:  211 SFDDEEPLLDELGIHPDQIWKKTKSILNPFRV-NPTVHKGSDLSGPIVLYLSFGLFQLLAGKLQFGVILGWIVVSSIFLYVVFNMLAGRNGNLDLHTCTSVVGYCMLPVVILAAFSLFLPQGGAIRFAVSAVFVLWAARASTNLMVSLADGGEEHRGLIAYACFLIYTLFSLLVIF 735
            +F+DE PLL+ELGI+ D IW+KT ++L+P +V + ++   +DL+GP+V  L+FG   LLAGK+QFG + G   +  + ++ + N+++     +      SV+GYC+LP+++L++F++     G +   ++A  + W + +++ + +S A   E  + L+AY C L+Y +F+L+ +F
Sbjct:   85 NFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMS--MTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFIS-ALAMEGQQLLVAYPCALLYGVFALISVF 257          
The following BLAST results are available for this feature:
BLAST of CF836046 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
YIPF5_XENTR1.729e-2835.96Protein YIPF5 OS=Xenopus tropicalis GN=yipf5 PE=2 ... [more]
YIPF7_HUMAN2.258e-2836.93Protein YIPF7 OS=Homo sapiens GN=YIPF7 PE=1 SV=2[more]
YIPF5_XENLA2.950e-2835.96Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1[more]
YIPF5_DANRE1.121e-2735.20Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1[more]
YIPF7_MOUSE4.259e-2734.66Protein YIPF7 OS=Mus musculus GN=Yipf7 PE=2 SV=1[more]
YIPF5_RAT4.259e-2734.46Protein YIPF5 OS=Rattus norvegicus GN=Yipf5 PE=2 S... [more]
YIPF5_MOUSE5.563e-2734.46Protein YIPF5 OS=Mus musculus GN=Yipf5 PE=2 SV=1[more]
YIPF5_MACFA5.563e-2734.66Protein YIPF5 OS=Macaca fascicularis GN=YIPF5 PE=2... [more]
YIPF5_PONAB1.239e-2634.09Protein YIPF5 OS=Pongo abelii GN=YIPF5 PE=2 SV=1[more]
YIPF5_HUMAN1.239e-2634.09Protein YIPF5 OS=Homo sapiens GN=YIPF5 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_02F08_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02F08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF836046 ID=CF836046; Name=CF836046; organism=Citrus sinensis; type=EST; length=752bp
TTTTTTTTTTTTTTTTGAGCTAACATATTCAATTCAATATCATGACCTCG
TGCAGAGATAAAAACATGTCTTTTCACCTAATGATATCGTGAGTGATTCA
CTCACAGCTATAAAAACACTGCATTAATCTAAAATCACATCACAAATCCC
CTAAATTCAATGCAAAATTCCAATTCATCCAATGCCAACCAATAACTCAC
TCGCCCATCAAAATATAACAAGAAGTGAAAACAGTGTGTAAATCAAGAAA
CAAGCATACGCAATCAACCCGCGGTGTTCCTCTCCTCCATCAGCCAACGA
AACCATCAGATTCGTGGAAGCCCTCGCCGCCCACAGTACAAACACCGCGG
ACACGGCAAACCGAATCGCCCCACCTTGCGGCAAGAACAGAGAAAATGCC
GCTAGGATCACCACCGGTAGCATACAGTAACCAACCACGCTGGTACACGT
GTGCAAGTCAAGATTCCCATTACGTCCCGCTAGCATGTTAAAAACAACAT
ACAAAAAGATCGACGAGACCACGATCCAACCAAGAATCACGCCGAATTGA
AGCTTGCCAGCGAGGAGTTGAAAGAGTCCGAATGAAAGGTAAAGTACAAT
CGGGCCGGATAGATCCGAACCTTTGTGAACCGTCGGATTTACACGAAACG
GATTTAAAATTGACTTTGTCTTTTTCCAGATTTGGTCTGGGTGGATACCG
AGCTCGTCGAGTAGAGGCTCTTCGTCGTCGAATGACGCTGACCCACCGGC
TG
back to top