CF836235

Overview
NameCF836235
Unique NameCF836235
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length715
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8153 contig Csv1_Contig8153:570..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF836235 vs. ExPASy Swiss-Prot
Match: ANGLT_ROSHC (Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hybrid cultivar GN=RhGT1 PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.844e-38
Identity = 86/227 (37.89%), Postives = 131/227 (57.71%), Query Frame = 3
Query:   33 DYIASVSATAPSVTFHQLPPPVSRIPDTLRSPADFPALVYELGELNNPNLHETLITISKRSNLKAFVIDFLCNPAFQVSSSTLSIPTYYYFTTAGSVLAANLYLPTLHKNTTKSFRELGSALLNFPGFPPFPARDMALPMHDREGKVYKGLVDTGIQMAKSAGIIVNTFELLQERAIKAMLEGQCIPGETLPPLYCIGPVVXXXXXXXXXXXXHECLSWLDSKPSRS 713
            +YI +VSA  P++ FH LP  +S +P+ +        L +E   L  PN+ + L T+  +S+LKA ++D  C+  F V+   L+IPT+Y++T+AG  LA  L +PT H+ TT S  + G   ++  G PP P   M   + DR    YK  + T   MAKS GII+NTF+LL+ERA+KA+  G C+P +  PP++ +GP++            HE L WL+++P  S
Sbjct:   63 NYIKAVSADNPAINFHHLPT-ISSLPEHIEKLN----LPFEYARLQIPNILQVLQTL--KSSLKALILDMFCDALFDVTKD-LNIPTFYFYTSAGRSLAVLLNIPTFHR-TTNSLSDFGDVPISISGMPPIPVSAMPKLLFDRSTNFYKSFLSTSTHMAKSNGIILNTFDLLEERALKALRAGLCLPNQPTPPIFTVGPLI---SGKSGDNDEHESLKWLNNQPKDS 277          
BLAST of CF836235 vs. ExPASy Swiss-Prot
Match: HQGT_ARATH (Probable hydroquinone glucosyltransferase OS=Arabidopsis thaliana GN=At4g01070 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.016e-19
Identity = 61/180 (33.89%), Postives = 90/180 (50.00%), Query Frame = 3
Query:  168 NNPNLHETLITISKRSNLK-AFVIDFLCNPAFQVSSSTLSIPTYYYFTTAGSVLAANLYLPTLHKNTTKSFRELGSALLNFPGFPPFPARDMALPMHDREGKVYKGLVDTGIQMAKSAGIIVNTFELLQERAIKAMLEGQCIPGETLPPLYCIGPVVXXXXXXXXXXXXHECLSWLDSKP 704
            +NP L +   +  +   L  A V+D     AF V+     +P Y ++ T  +VL+  L+LP L +  +  FREL   L+  PG  P   +D   P  DR+   YK L+    +  ++ GI+VNTF  L+  AIKA+ E    PG   PP+Y +GP+V             ECL WLD++P
Sbjct:   93 SNPELRKVFDSFVEGGRLPTALVVDLFGTDAFDVAVE-FHVPPYIFYPTTANVLSFFLHLPKLDETVSCEFRELTEPLM-LPGCVPVAGKDFLDPAQDRKDDAYKWLLHNTKRYKEAEGILVNTFFELEPNAIKALQE----PGLDKPPVYPVGPLVNIGKQEAKQTEESECLKWLDNQP 266          
BLAST of CF836235 vs. ExPASy Swiss-Prot
Match: HQGT_RAUSE (Hydroquinone glucosyltransferase OS=Rauvolfia serpentina GN=AS PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.166e-13
Identity = 51/180 (28.33%), Postives = 82/180 (45.56%), Query Frame = 3
Query:  174 PNLHETLITISKRSNLKAFVIDFLCNPAFQVSSSTLSIPTYYYFTTAGSVLAANLYLPTLHKNTTKSFRELGSALLNFPGFPPFPARDMALPMHDREGKVYKGLVDTGIQMAKSAGIIVNTFELLQERAIKAMLEGQCIPGETLPPLYCIGPVVXXXXXXXXXXXXHECLSWLDSKPSRS 713
            P + + + T+   + L A V+D     AF V+     +  Y ++ T    L+   +LP L +  +  +R++   L   PG  P   +D   P  DR+   YK L+    +   + GI+VNTF  L+   +KA+ E      +  PP+Y IGP++             ECL WLD +P  S
Sbjct:   93 PFVRDAVKTLLATTKLAALVVDLFGTDAFDVAIE-FKVSPYIFYPTTAMCLSLFFHLPKLDQMVSCEYRDVPEPL-QIPGCIPIHGKDFLDPAQDRKNDAYKCLLHQAKRYRLAEGIMVNTFNDLEPGPLKALQE----EDQGKPPVYPIGPLIRADSSSKVDDC--ECLKWLDDQPRGS 264          
The following BLAST results are available for this feature:
BLAST of CF836235 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ANGLT_ROSHC2.844e-3837.89Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hy... [more]
HQGT_ARATH1.016e-1933.89Probable hydroquinone glucosyltransferase OS=Arabi... [more]
HQGT_RAUSE3.166e-1328.33Hydroquinone glucosyltransferase OS=Rauvolfia serp... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_02K05_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02K05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF836235 ID=CF836235; Name=CF836235; organism=Citrus sinensis; type=EST; length=715bp
CCGCCCCGTTCGTTACAAGCGCCGGTACCGATGATTACATCGCCTCCGTC
TCCGCCACAGCTCCCTCCGTTACCTTCCACCAGCTCCCTCCTCCGGTTTC
CCGCATACCCGACACTTTACGTTCACCAGCTGACTTCCCAGCCTTAGTGT
ACGAGCTTGGCGAGCTCAACAACCCTAATCTCCACGAAACCCTAATAACA
ATTTCCAAACGCTCAAACCTGAAAGCCTTTGTTATCGATTTCCTTTGCAA
CCCCGCGTTTCAAGTTTCCTCGAGTACTCTCAGTATCCCTACTTACTATT
ACTTCACCACCGCAGGAAGCGTACTCGCTGCTAACCTCTACTTACCAACT
CTTCATAAAAACACCACAAAGAGCTTCAGAGAACTCGGCAGCGCGCTTTT
AAATTTCCCCGGATTTCCGCCTTTTCCAGCAAGAGACATGGCGTTACCCA
TGCATGATCGTGAGGGTAAAGTATACAAGGGCTTAGTCGACACCGGCATC
CAGATGGCAAAATCTGCGGGGATTATTGTAAACACATTTGAATTGCTCCA
AGAGAGAGCTATCAAAGCGATGCTAGAAGGACAATGCATTCCAGGGGAGA
CGTTGCCGCCTTTATATTGCATAGGGCCCGTGGTTGGTCGAGGAAATGGA
GAGAATCGAGGACGTGATCGACATGAATGCTTGAGCTGGCTTGACTCGAA
ACCGAGTCGAAGCGT
back to top