CF836493

Overview
NameCF836493
Unique NameCF836493
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length658
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1250 contig Csv1_Contig1250:174..831. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF836493 vs. ExPASy Swiss-Prot
Match: UMEC_ARMRU (Umecyanin OS=Armoracia rusticana PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.103e-13
Identity = 30/60 (50.00%), Postives = 41/60 (68.33%), Query Frame = -2
Query:  475 HDLTVVTRQAYDSCSTANAVNRITNGPARVRLNTTGQHYYICGFPGHCAAGQKLTVNVVG 654
            HD+ VVT+ A+D+C   N ++ +T  P ++ LNTTG  YYIC    HC  GQKL++NVVG
Sbjct:   44 HDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVG 103          
The following BLAST results are available for this feature:
BLAST of CF836493 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
UMEC_ARMRU6.103e-1350.00Umecyanin OS=Armoracia rusticana PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_03B01_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa03B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF836493 ID=CF836493; Name=CF836493; organism=Citrus sinensis; type=EST; length=658bp
TTTTTTTTTTTTTTTATAATTAATAATCATATGACTGTTATTAATCGAGA
AAAGCGAAAATCAGAAACGACATAAACTATGATCATTGATCCCCATAAAA
ATCATAGTGACGCGGCTGCTGATGAATAAGAAATGAATTACAAACAGCCT
TATTCAAAAACAAAATTCTCAAACAATCATCACGATCAAATGAATATGTC
TGTATTCTGTCCAGTAAAAACCATAGCAATAAAGAAAACTAAAAGACCCT
CATAAGCAAGCAATATATGGTATAGCCGCCTAGTAGAACAAGCCTACGGC
AACGAACATCAAGACGGCAGCAAAGCTAACGCCTATTGGGGCAGTGTCAG
AAGGTGGCGGTGCTTGCGTGGAAGGAGTAGTATCAGTGCCGGTGCCAGAA
GGACCAGGGGGTGCGGGAGAAGTGCCAGGGCCGCCGCCGGCAGAAGGAGC
AGGGGCTGAGCCGCCGGAGTTGTTACCAACAACGTTAACGGTCAACTTTT
GGCCGGCGGCGCAGTGACCGGGGAACCCGCATATGTAGTAGTGCTGACCA
GTTGTGTTGAGGCGAACCCTTGCCGGTCCATTTGTTATGCGATTGACGGC
GTTGGCCGTGCTGCATGAATCATAAGCTTGCCTTGTCACTACAGTCAAGT
CATGTGCT
back to top