CK702010

Overview
NameCK702010
Unique NameCK702010
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length250
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK702010_ssr1 microsatellite CK702010_ssr1:1..34. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.212e-14
Identity = 42/71 (59.15%), Postives = 51/71 (71.83%), Query Frame = 1
Query:   40 DNFLGKGGFGRVYKGTLRS-GEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYCAHGKHR 249
            D FLG+GGFGRVYKG L S G+VVA+K+++    +   G  EF VEV +LS L HPNLV+LIGYCA G  R
Sbjct:   89 DTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQ---GNREFLVEVLMLSLLHHPNLVNLIGYCADGDQR 156          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: CRK41_ARATH (Cysteine-rich receptor-like protein kinase 41 OS=Arabidopsis thaliana GN=CRK41 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.763e-12
Identity = 33/70 (47.14%), Postives = 48/70 (68.57%), Query Frame = 1
Query:   40 DNFLGKGGFGRVYKGTLRSGEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYCAHGKHR 249
            DN LG+GGFG VYKG L  GE +A+K++ +   K   G++EF  EV ++++L H NLV L+G+C  G+ R
Sbjct:  347 DNQLGEGGFGAVYKGVLDYGEEIAVKRLSM---KSGQGDNEFINEVSLVAKLQHRNLVRLLGFCLQGEER 413          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: Y1684_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana GN=At1g06840 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 2.302e-12
Identity = 37/69 (53.62%), Postives = 49/69 (71.01%), Query Frame = 1
Query:   40 DNF-----LGKGGFGRVYKGTLRSGEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYC 231
            DNF     +G+GG+G+VYKGTL SG VVAIK+ +    +   GE EF  E+++LSRL H NLVSL+G+C
Sbjct:  623 DNFNSSTQIGQGGYGKVYKGTLGSGTVVAIKRAQEGSLQ---GEKEFLTEIELLSRLHHRNLVSLLGFC 688          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: RLK7_ARATH (Receptor-like protein kinase At5g59670 OS=Arabidopsis thaliana GN=At5g59670 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.698e-12
Identity = 33/66 (50.00%), Postives = 42/66 (63.64%), Query Frame = 1
Query:   49 LGKGGFGRVYKGTLRSGEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYCAHGKH 246
            LGKGGFG VY GT++  E VA+K +         G  EF+ EVD+L R+ H NLVSL+GYC  G +
Sbjct:  570 LGKGGFGMVYHGTVKGSEQVAVKVLSQ---SSTQGSKEFKAEVDLLLRVHHTNLVSLVGYCCEGDY 632          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: THE1_ARATH (Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.748e-12
Identity = 36/65 (55.38%), Postives = 47/65 (72.31%), Query Frame = 1
Query:   37 DDNFLGKGGFGRVYKGTLRSGEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYC 231
            + + LG GGFGRVYKGTL  G  VA+K+   PR ++  G  EFR E+++LS+L H +LVSLIGYC
Sbjct:  512 ESSLLGVGGFGRVYKGTLEDGTKVAVKRGN-PRSEQ--GMAEFRTEIEMLSKLRHRHLVSLIGYC 573          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: RLCK7_ARATH (Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.748e-12
Identity = 38/71 (53.52%), Postives = 47/71 (66.20%), Query Frame = 1
Query:   40 DNFLGKGGFGRVYKGTLRS-GEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYCAHGKHR 249
            D FLG+GGFG+V+KGT+    +VVAIK+++        G  EF VEV  LS  DHPNLV LIG+CA G  R
Sbjct:  106 DCFLGEGGFGKVFKGTIEKLDQVVAIKQLDR---NGVQGIREFVVEVLTLSLADHPNLVKLIGFCAEGDQR 173          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: CRK25_ARATH (Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.748e-12
Identity = 33/71 (46.48%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   37 DDNFLGKGGFGRVYKGTLRSGEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYCAHGKHR 249
            + N LG GGFG VYKG L +GE VAIK++         G  EF+ EVD++++L H NL  L+GYC  G+ +
Sbjct:  349 ESNKLGHGGFGEVYKGQLITGETVAIKRLSQ---GSTQGAEEFKNEVDVVAKLQHRNLAKLLGYCLDGEEK 416          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: CRK19_ARATH (Cysteine-rich receptor-like protein kinase 19 OS=Arabidopsis thaliana GN=CRK19 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 8.748e-12
Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 1
Query:   43 NFLGKGGFGRVYKGTLRSGEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYCAHGKHR 249
            N LG+GGFG VYKGTL SG  VA+K++         GE EF  EV ++++L H NLV L+GYC  G+ +
Sbjct:  330 NKLGQGGFGEVYKGTLSSGLQVAVKRLSK---TSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEK 395          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: CRK39_ARATH (Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.492e-11
Identity = 33/67 (49.25%), Postives = 46/67 (68.66%), Query Frame = 1
Query:   40 DNFLGKGGFGRVYKGTLRSGEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYCAHG 240
            +N LG+GGFG VYKGTL +G+ VA+K++         G+ EF+ EV +L+RL H NLV L+G+C  G
Sbjct:  356 ENTLGQGGFGTVYKGTLLNGQEVAVKRLTK---GSGQGDIEFKNEVSLLTRLQHRNLVKLLGFCNEG 419          
BLAST of CK702010 vs. ExPASy Swiss-Prot
Match: CRK20_ARATH (Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 1.949e-11
Identity = 33/69 (47.83%), Postives = 44/69 (63.77%), Query Frame = 1
Query:   43 NFLGKGGFGRVYKGTLRSGEVVAIKKMELPRFKEADGEHEFRVEVDILSRLDHPNLVSLIGYCAHGKHR 249
            N LG+GGFG VYKGT  SG  VA+K++         GE EF  EV ++++L H NLV L+GYC  G+ +
Sbjct:  348 NKLGQGGFGEVYKGTFPSGVQVAVKRLSK---NSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEK 413          
The following BLAST results are available for this feature:
BLAST of CK702010 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
PBS1_ARATH3.212e-1459.15Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
CRK41_ARATH1.763e-1247.14Cysteine-rich receptor-like protein kinase 41 OS=A... [more]
Y1684_ARATH2.302e-1253.62Probable LRR receptor-like serine/threonine-protei... [more]
RLK7_ARATH6.698e-1250.00Receptor-like protein kinase At5g59670 OS=Arabidop... [more]
THE1_ARATH8.748e-1255.38Receptor-like protein kinase THESEUS 1 OS=Arabidop... [more]
RLCK7_ARATH8.748e-1253.52Probable serine/threonine-protein kinase RLCKVII O... [more]
CRK25_ARATH8.748e-1246.48Cysteine-rich receptor-like protein kinase 25 OS=A... [more]
CRK19_ARATH8.748e-1249.28Cysteine-rich receptor-like protein kinase 19 OS=A... [more]
CRK39_ARATH1.492e-1149.25Putative cysteine-rich receptor-like protein kinas... [more]
CRK20_ARATH1.949e-1147.83Putative cysteine-rich receptor-like protein kinas... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_5271 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE44E11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK702010 ID=CK702010|Name=CK702010|organism=Citrus sinensis|type=EST|length=250bp
CTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCCGATGACAACTTTCT
TGGGAAAGGGGGGTTTGGCCGAGTTTACAAGGGCACTCTGCGGTCAGGAG
AGGTGGTTGCAATCAAGAAAATGGAGCTGCCACGATTTAAAGAAGCTGAC
GGGGAACACGAGTTCCGCGTAGAAGTTGATATCTTGAGCAGACTTGACCA
TCCAAATCTGGTCTCTTTGATAGGCTATTGTGCACATGGGAAGCACCGGT
back to top