CK739949
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CK739949 vs. ExPASy Swiss-Prot
Match: RL10_VITRI (60S ribosomal protein L10 OS=Vitis riparia GN=RPL10 PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 2.977e-14 Identity = 32/41 (78.05%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 2 DYLRWKSENRIVPDGVNAKLLGCHGPLAQRQPGRAFLEATT 124 DY++WKS+NRI+PDGVNAKLLGCHGPLA RQPG+AF+ A T Sbjct: 180 DYIKWKSQNRILPDGVNAKLLGCHGPLANRQPGKAFINACT 220
BLAST of CK739949 vs. ExPASy Swiss-Prot
Match: RL10_TOBAC (60S ribosomal protein L10 (Fragment) OS=Nicotiana tabacum GN=RPL10 PE=2 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.131e-13 Identity = 35/39 (89.74%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 DYLRWKSENRIVPDGVNAKLLGCHGPLAQRQPGRAFLEA 118 DYL++KSENRIVPDGVNAKLLGCHG LA RQPGRAFLEA Sbjct: 109 DYLKYKSENRIVPDGVNAKLLGCHGRLAARQPGRAFLEA 147
BLAST of CK739949 vs. ExPASy Swiss-Prot
Match: RL10_SOLME (60S ribosomal protein L10 OS=Solanum melongena GN=RPL10 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.634e-12 Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 2 Query: 2 DYLRWKSENRIVPDGVNAKLLGCHGPLAQRQPGRAFLEAT 121 DYL++KSENRIVPDGVNAKLLG HGPLA RQPGRAFL ++ Sbjct: 180 DYLKYKSENRIVPDGVNAKLLGNHGPLAARQPGRAFLSSS 219
BLAST of CK739949 vs. ExPASy Swiss-Prot
Match: RL10_PINTA (60S ribosomal protein L10 OS=Pinus taeda GN=RPL10 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 8.108e-12 Identity = 29/38 (76.32%), Postives = 35/38 (92.11%), Query Frame = 2 Query: 2 DYLRWKSENRIVPDGVNAKLLGCHGPLAQRQPGRAFLE 115 DYL+WK+ENRIVPDGVN KLLGC GPL+ R+PG+AFL+ Sbjct: 180 DYLKWKTENRIVPDGVNPKLLGCRGPLSNRKPGQAFLK 217
BLAST of CK739949 vs. ExPASy Swiss-Prot
Match: RL10_EUPES (60S ribosomal protein L10 OS=Euphorbia esula GN=RPL10 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.806e-11 Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 2 Query: 2 DYLRWKSENRIVPDGVNAKLLGCHGPLAQRQPGRAFLEA 118 DY R KSENRI+PDGVNAKLLGCHG LA R+PGRAF++A Sbjct: 180 DYPRLKSENRILPDGVNAKLLGCHGRLANRKPGRAFIDA 218 The following BLAST results are available for this feature:
BLAST of CK739949 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK739949 ID=CK739949; Name=CK739949; organism=Citrus sinensis; type=EST; length=493bpback to top |