CK740116

Overview
NameCK740116
Unique NameCK740116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length443
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP1_ARATH (Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thaliana GN=PARP1 PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 3.437e-58
Identity = 67/91 (73.63%), Postives = 76/91 (83.52%), Query Frame = 2
Query:  170 KYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            KYL+TTHAPTHT+WSLELEEVF+LEREGEFDK++ ++ KL N+MLLWHGSR+TNFVGIL Q           TGYMFGKGIYFADLVSKSA
Sbjct:  786 KYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSA 876          

HSP 2 Score: 103.605 bits (257), Expect = 3.437e-58
Identity = 49/56 (87.50%), Postives = 54/56 (96.43%), Query Frame = 3
Query:    3 FKSKVKMLEALQDIEIASRLVGFDVDSDDSLDEKYKKLRCDIAPLPHDSEDYQLIE 170
            FKSKVKMLEALQDIEIASR+VGFDVDS +SLD+KYKKL CDI+PLPHDSEDY+LIE
Sbjct:  730 FKSKVKMLEALQDIEIASRIVGFDVDSTESLDDKYKKLHCDISPLPHDSEDYRLIE 785          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP1_ORYSJ (Poly [ADP-ribose] polymerase 1 OS=Oryza sativa subsp. japonica GN=PARP1 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 3.345e-52
Identity = 62/91 (68.13%), Postives = 72/91 (79.12%), Query Frame = 2
Query:  170 KYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            KYL  THAPTH +WSLELEEVFSL+R+GEF K+S Y+  L N+MLLWHGSR+TN+VGIL+Q           TGYMFGKG+YFADLVSKSA
Sbjct:  780 KYLLNTHAPTHKEWSLELEEVFSLDRDGEFSKYSRYKNNLHNKMLLWHGSRLTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSA 870          

HSP 2 Score: 92.8189 bits (229), Expect = 3.345e-52
Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 3
Query:   12 KVKMLEALQDIEIASRLVGFDVDSDDSLDEKYKKLRCDIAPLPHDSEDYQLIE 170
            KVKMLEALQDIEIAS+LVGFD D+D+SLD+KYKKLRC I PLPHD EDY+L+E
Sbjct:  727 KVKMLEALQDIEIASKLVGFDSDNDESLDDKYKKLRCAITPLPHDCEDYKLVE 779          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP1_MAIZE (Poly [ADP-ribose] polymerase 1 OS=Zea mays GN=PARP1 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 4.737e-51
Identity = 62/91 (68.13%), Postives = 72/91 (79.12%), Query Frame = 2
Query:  170 KYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            +YL  THAPTH DWSLELEEVFSL+R+GE +K+S Y+  L N+MLLWHGSR+TNFVGIL+Q           TGYMFGKG+YFADLVSKSA
Sbjct:  783 QYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSA 873          

HSP 2 Score: 89.7373 bits (221), Expect = 4.737e-51
Identity = 42/53 (79.25%), Postives = 47/53 (88.68%), Query Frame = 3
Query:   12 KVKMLEALQDIEIASRLVGFDVDSDDSLDEKYKKLRCDIAPLPHDSEDYQLIE 170
            K KMLEALQDIEIAS++VGFD DSD+SLD+KY KL CDI PL HDSEDY+LIE
Sbjct:  730 KAKMLEALQDIEIASKIVGFDSDSDESLDDKYMKLHCDITPLAHDSEDYKLIE 782          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP2_MAIZE (Poly [ADP-ribose] polymerase 2 OS=Zea mays GN=PARP2 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.054e-30
Identity = 42/90 (46.67%), Postives = 61/90 (67.78%), Query Frame = 2
Query:  173 YLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            YL  TH  TH+ +++++ ++F + R GE ++F  +    +NRMLLWHGSR++N+ GIL+Q           TGYMFGKG+YFAD+ SKSA
Sbjct:  456 YLRNTHGKTHSGYTVDIVQIFKVSRHGETERFQKFA-STRNRMLLWHGSRLSNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSA 544          

HSP 2 Score: 56.6102 bits (135), Expect = 5.054e-30
Identity = 28/57 (49.12%), Postives = 42/57 (73.68%), Query Frame = 3
Query:    6 KSKVKMLEALQDIEIASRLVGFDV-DSDDSLDEKYKKLRCDIAPLPHDSEDYQLIES 173
            K+K++M+EAL +IEIA++L+  D  D DD L  +YK+L CD  PL  DS++Y +I+S
Sbjct:  399 KAKLEMVEALGEIEIATKLLEDDSSDQDDPLYARYKQLHCDFTPLEADSDEYSMIKS 455          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PRP2A_ORYSJ (Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa subsp. japonica GN=PARP2-A PE=3 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.452e-29
Identity = 44/90 (48.89%), Postives = 60/90 (66.67%), Query Frame = 2
Query:  173 YLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            YL  TH  THT +++++ ++F + R GE ++F  +     NRMLLWHGSR+TN+ GIL+Q           TGYMFGKG+YFAD+ SKSA
Sbjct:  463 YLANTHGKTHTSYTVDVVQIFKVSRHGEMERFQKFATA-GNRMLLWHGSRLTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSA 551          

HSP 2 Score: 53.9138 bits (128), Expect = 1.452e-29
Identity = 27/57 (47.37%), Postives = 41/57 (71.93%), Query Frame = 3
Query:    6 KSKVKMLEALQDIEIASRLVGFD-VDSDDSLDEKYKKLRCDIAPLPHDSEDYQLIES 173
            K+K++M+EAL +IEIA++L+  D  D DD L  +YK+L CD  PL   SE+Y +I++
Sbjct:  406 KAKLEMVEALGEIEIATKLLEDDSTDQDDPLYARYKQLSCDFTPLEVGSEEYSMIKT 462          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP2_MOUSE (Poly [ADP-ribose] polymerase 2 OS=Mus musculus GN=Parp2 PE=1 SV=3)

HSP 1 Score: 102.449 bits (254), Expect = 1.456e-29
Identity = 50/91 (54.95%), Postives = 65/91 (71.43%), Query Frame = 2
Query:  170 KYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            +YL +THAPTH D+++ L +VF +E+EGE + F   +  L NRMLLWHGSR++N+VGIL+            TGYMFGKGIYFAD+ SKSA
Sbjct:  360 QYLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAF---REDLPNRMLLWHGSRLSNWVGILSHGLRVAPPEAPITGYMFGKGIYFADMSSKSA 447          

HSP 2 Score: 47.7506 bits (112), Expect = 1.456e-29
Identity = 24/53 (45.28%), Postives = 36/53 (67.92%), Query Frame = 3
Query:   12 KVKMLEALQDIEIASRLVGFDVDS-DDSLDEKYKKLRCDIAPLPHDSEDYQLI 167
            KVK+LEAL DIEIA +LV  +    +  LD+ Y+ L C + PL H+S ++++I
Sbjct:  306 KVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVI 358          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP1_RAT (Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicus GN=Parp1 PE=2 SV=4)

HSP 1 Score: 105.916 bits (263), Expect = 1.880e-29
Identity = 51/91 (56.04%), Postives = 63/91 (69.23%), Query Frame = 2
Query:  170 KYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            KY+  THA TH  + LE+ ++F +EREGE  ++  + R+L NR LLWHGSR TNF GIL+Q           TGYMFGKGIYFAD+VSKSA
Sbjct:  816 KYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPF-RQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSA 905          

HSP 2 Score: 43.8986 bits (102), Expect = 1.880e-29
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = 3
Query:    6 KSKVKMLEALQDIEIASRLV--GFDVDSDDSLDEKYKKLRCDIAPLPHDSEDYQLI 167
            ++KV+ML+ L DIE+A  L+  G D  S D +D  Y+KL+ DI  +  DSE+ ++I
Sbjct:  759 QAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVI 814          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP1_MOUSE (Poly [ADP-ribose] polymerase 1 OS=Mus musculus GN=Parp1 PE=1 SV=3)

HSP 1 Score: 105.916 bits (263), Expect = 1.880e-29
Identity = 51/91 (56.04%), Postives = 63/91 (69.23%), Query Frame = 2
Query:  170 KYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            KY+  THA TH  + LE+ ++F +EREGE  ++  + R+L NR LLWHGSR TNF GIL+Q           TGYMFGKGIYFAD+VSKSA
Sbjct:  815 KYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPF-RQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSA 904          

HSP 2 Score: 43.8986 bits (102), Expect = 1.880e-29
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = 3
Query:    6 KSKVKMLEALQDIEIASRLV--GFDVDSDDSLDEKYKKLRCDIAPLPHDSEDYQLI 167
            ++KV+ML+ L DIE+A  L+  G D  S D +D  Y+KL+ DI  +  DSE+ ++I
Sbjct:  758 QAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVI 813          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP1_BOVIN (Poly [ADP-ribose] polymerase 1 OS=Bos taurus GN=PARP1 PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.186e-29
Identity = 50/91 (54.95%), Postives = 63/91 (69.23%), Query Frame = 2
Query:  170 KYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            KY+  THA TH  + LE+ ++F +EREGE  ++  + ++L NR LLWHGSR TNF GIL+Q           TGYMFGKGIYFAD+VSKSA
Sbjct:  818 KYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSA 907          

HSP 2 Score: 43.8986 bits (102), Expect = 3.186e-29
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = 3
Query:    6 KSKVKMLEALQDIEIASRLV--GFDVDSDDSLDEKYKKLRCDIAPLPHDSEDYQLI 167
            ++KV+ML+ L DIE+A  L+  G D  S D +D  Y+KL+ DI  +  DSE+ ++I
Sbjct:  761 QAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDKDSEEAEII 816          
BLAST of CK740116 vs. ExPASy Swiss-Prot
Match: PARP1_CRIGR (Poly [ADP-ribose] polymerase 1 OS=Cricetulus griseus GN=PARP1 PE=2 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 3.186e-29
Identity = 50/91 (54.95%), Postives = 63/91 (69.23%), Query Frame = 2
Query:  170 KYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSRVTNFVGILTQDXXXXXXXXXXTGYMFGKGIYFADLVSKSA 442
            KY+  THA TH  + LE+ ++F +EREGE  ++  + ++L NR LLWHGSR TNF GIL+Q           TGYMFGKGIYFAD+VSKSA
Sbjct:  815 KYVKNTHATTHNAYDLEVMDIFKIEREGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSA 904          

HSP 2 Score: 43.8986 bits (102), Expect = 3.186e-29
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = 3
Query:    6 KSKVKMLEALQDIEIASRLV--GFDVDSDDSLDEKYKKLRCDIAPLPHDSEDYQLI 167
            ++KV+ML+ L DIE+A  L+  G D  S D +D  Y+KL+ DI  +  DSE+ ++I
Sbjct:  758 QAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVI 813          
The following BLAST results are available for this feature:
BLAST of CK740116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
PARP1_ARATH3.437e-5873.63Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thal... [more]
PARP1_ORYSJ3.345e-5268.13Poly [ADP-ribose] polymerase 1 OS=Oryza sativa sub... [more]
PARP1_MAIZE4.737e-5168.13Poly [ADP-ribose] polymerase 1 OS=Zea mays GN=PARP... [more]
PARP2_MAIZE5.054e-3046.67Poly [ADP-ribose] polymerase 2 OS=Zea mays GN=PARP... [more]
PRP2A_ORYSJ1.452e-2948.89Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa s... [more]
PARP2_MOUSE1.456e-2954.95Poly [ADP-ribose] polymerase 2 OS=Mus musculus GN=... [more]
PARP1_RAT1.880e-2956.04Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicu... [more]
PARP1_MOUSE1.880e-2956.04Poly [ADP-ribose] polymerase 1 OS=Mus musculus GN=... [more]
PARP1_BOVIN3.186e-2954.95Poly [ADP-ribose] polymerase 1 OS=Bos taurus GN=PA... [more]
PARP1_CRIGR3.186e-2954.95Poly [ADP-ribose] polymerase 1 OS=Cricetulus grise... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6610 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE65F03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740116 ID=CK740116|Name=CK740116|organism=Citrus sinensis|type=EST|length=443bp
ATTTTAAGTCAAAGGTGAAAATGCTAGAAGCTCTGCAGGACATTGAAATA
GCTTCAAGATTAGTAGGTTTTGATGTTGATAGTGATGATTCCCTGGATGA
GAAATATAAGAAGCTTCGTTGTGATATTGCTCCACTTCCGCATGATAGTG
AGGATTACCAACTGATTGAAAGTACCTCCATACTACGCATGCCCCTACTC
ATACTGATTGGTCACTGGAACTGGAAGAAGTTTTTTCACTTGAAAGGGAA
GGGGAATTTGATAAGTTTTCTTCTTATCAAAGAAAGCTTAAAAATAGAAT
GCTCCTCTGGCATGGGTCTCGGGTGACAAATTTTGTGGGAATCCTCACCC
AGGACTGAGAATAGCCCCCTCCTGAAGCACCGGCAACTGGCTATATGTTT
GGTAAGGGAATTTACTTTGCTGACCTAGTCAGTAAAAGTGCTC
back to top