CK740118

Overview
NameCK740118
Unique NameCK740118
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length444
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9870 contig Csv1_Contig9870:1168..1610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPE1_SOYBN (Arginine decarboxylase OS=Glycine max PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 7.757e-45
Identity = 70/82 (85.37%), Postives = 77/82 (93.90%), Query Frame = 1
Query:  100 YYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAEEYCGQEHGS 345
            YYLGMFLGGAYEEALGGVHNLFGGPSVVRV QSDGPHSFAVTRA+PGPSCGDVLRVMQH+P+LMFETLKHRA+EY   ++ +
Sbjct:  567 YYLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAVPGPSCGDVLRVMQHQPELMFETLKHRAQEYVSHDNAA 648          

HSP 2 Score: 48.1358 bits (113), Expect = 7.757e-45
Identity = 21/25 (84.00%), Postives = 22/25 (88.00%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTSLPLHEMVGG 77
            CDSDGKIDKFI G +SLPLHEM GG
Sbjct:  540 CDSDGKIDKFINGESSLPLHEMEGG 564          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPE1_ARATH (Arginine decarboxylase 1 OS=Arabidopsis thaliana GN=SPE1 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 4.825e-41
Identity = 67/78 (85.90%), Postives = 70/78 (89.74%), Query Frame = 1
Query:   88 SRGPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAEE 321
            S G YYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPH FAVTRA+ G S  DVLR MQHEP+LMF+TLKHRAEE
Sbjct:  551 SGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVMGQSSADVLRAMQHEPELMFQTLKHRAEE 628          

HSP 2 Score: 49.2914 bits (116), Expect = 4.825e-41
Identity = 21/27 (77.78%), Postives = 23/27 (85.19%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTSLPLHEMVGGGC 83
            CDSDGKI+KFIGG +SLPLHEM   GC
Sbjct:  524 CDSDGKINKFIGGESSLPLHEMDNNGC 550          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPE2_ARATH (Arginine decarboxylase 2 OS=Arabidopsis thaliana GN=SPE2 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.190e-41
Identity = 69/86 (80.23%), Postives = 74/86 (86.05%), Query Frame = 1
Query:   88 SRGPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAEEYCGQEHGS 345
            S G Y+LGMFLGGAYEEALGGVHNLFGGPSVVRV QSDGPHSFAVTRA+PG S  DVLR MQHEP+LMF+TLKHRAEE    + GS
Sbjct:  563 SGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAVPGQSSADVLRAMQHEPELMFQTLKHRAEEMMHTKGGS 648          

HSP 2 Score: 45.8246 bits (107), Expect = 8.190e-41
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTSLPLHEMVGGGCG 86
            CDSDGKI+KFIGG +SLPLHE+   G G
Sbjct:  537 CDSDGKINKFIGGESSLPLHELDKNGSG 564          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPE1_DIACA (Arginine decarboxylase OS=Dianthus caryophyllus GN=ADC PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.800e-40
Identity = 65/74 (87.84%), Postives = 69/74 (93.24%), Query Frame = 1
Query:  100 YYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAEE 321
            YYLGMFLGGAYEEALGGVHNLFGGPSVVRV QSDGP S+AVTRA+PGPS  DVLRVM HEP+LMF+TLKHRAEE
Sbjct:  576 YYLGMFLGGAYEEALGGVHNLFGGPSVVRVQQSDGPQSYAVTRAVPGPSSSDVLRVMHHEPELMFQTLKHRAEE 649          

HSP 2 Score: 46.595 bits (109), Expect = 6.800e-40
Identity = 20/25 (80.00%), Postives = 22/25 (88.00%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTSLPLHEMVGG 77
            CDSDGKIDKFIG  +SLPLHE+ GG
Sbjct:  549 CDSDGKIDKFIGDESSLPLHELSGG 573          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPE1_BRAJU (Arginine decarboxylase OS=Brassica juncea GN=ADC1 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 5.647e-39
Identity = 65/74 (87.84%), Postives = 67/74 (90.54%), Query Frame = 1
Query:  100 YYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAEE 321
            YYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQ DGPH FAVTRAM G S  DVLR MQHEP+LMF+TLKHRAEE
Sbjct:  556 YYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQKDGPHGFAVTRAMMGQSSADVLRAMQHEPELMFQTLKHRAEE 629          

HSP 2 Score: 44.669 bits (104), Expect = 5.647e-39
Identity = 19/26 (73.08%), Postives = 22/26 (84.62%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTSLPLHEMVGGG 80
            CDSDGKI+KFIGG +SLPLHE+   G
Sbjct:  530 CDSDGKINKFIGGESSLPLHELDNNG 555          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPE1_PEA (Arginine decarboxylase OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 3.569e-36
Identity = 70/80 (87.50%), Postives = 74/80 (92.50%), Query Frame = 1
Query:   94 GPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAEEYCGQ 333
            G YYLGMFLGG+YEEALGG+HNLFGGPSVVRVLQSDGPH FAVTRA+ G SC DVLRVMQHEPQLMFETLKHRA E+CGQ
Sbjct:  578 GGYYLGMFLGGSYEEALGGLHNLFGGPSVVRVLQSDGPHGFAVTRAVAGSSCADVLRVMQHEPQLMFETLKHRALEFCGQ 657          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPE1_ORYSJ (Arginine decarboxylase OS=Oryza sativa subsp. japonica GN=ADC1 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.050e-35
Identity = 59/73 (80.82%), Postives = 64/73 (87.67%), Query Frame = 1
Query:  100 YYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAE 318
            YYLGMFLGGAY+EALGG+HNLFGGPSVVRV QSDGPH FAVTRA  GPSC DVLR MQHEP++MFE LK R +
Sbjct:  569 YYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAAGPSCADVLRSMQHEPEVMFEVLKQRTD 641          

HSP 2 Score: 41.5874 bits (96), Expect = 2.050e-35
Identity = 17/22 (77.27%), Postives = 19/22 (86.36%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTSLPLHEM 68
            CDSDGK+D FIGG  SLPLHE+
Sbjct:  540 CDSDGKVDHFIGGRHSLPLHEL 561          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPE1_SOLLC (Arginine decarboxylase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.570e-24
Identity = 38/42 (90.48%), Postives = 40/42 (95.24%), Query Frame = 1
Query:   94 GPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFA 219
            G YYLGMFLGGAYEEALGG+HNLFGGPSVVRV+QSD PHSFA
Sbjct:  461 GRYYLGMFLGGAYEEALGGLHNLFGGPSVVRVMQSDSPHSFA 502          

HSP 2 Score: 47.3654 bits (111), Expect = 4.570e-24
Identity = 21/35 (60.00%), Postives = 26/35 (74.29%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTSLPLHEMVGGGCGEPWALLF 107
            CDSDGK+DKFIGG +SLPLHE+  G  G  +  +F
Sbjct:  434 CDSDGKVDKFIGGESSLPLHEIGSGDGGRYYLGMF 468          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPEA_SYNR3 (Biosynthetic arginine decarboxylase OS=Synechococcus sp. (strain RCC307) GN=speA PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.766e-16
Identity = 32/78 (41.03%), Postives = 48/78 (61.54%), Query Frame = 1
Query:   97 PYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAEEYCG 330
            PY++G+FLGGAY+E +G +HNLFG  + V +  S G   + V   + G +  DVL  M+H P+ + E L+  +EE  G
Sbjct:  536 PYWIGLFLGGAYQEVMGNLHNLFGSTNAVSIRLSPG-GPYRVEHVVRGQTNSDVLEAMEHNPEALLERLRQASEEAIG 612          

HSP 2 Score: 34.2686 bits (77), Expect = 5.766e-16
Identity = 18/36 (50.00%), Postives = 23/36 (63.89%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTSLPLHEMVGGGCGEP-WALLF 107
            CDSDGK+ +FI  G++ PL E+     GEP W  LF
Sbjct:  507 CDSDGKLARFIASGSAKPLLELHELKDGEPYWIGLF 542          
BLAST of CK740118 vs. ExPASy Swiss-Prot
Match: SPEA_SYNPX (Biosynthetic arginine decarboxylase OS=Synechococcus sp. (strain WH8102) GN=speA PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 6.423e-14
Identity = 30/74 (40.54%), Postives = 47/74 (63.51%), Query Frame = 1
Query:   97 PYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPQLMFETLKHRAE 318
            PY +G+FL GAY+E +G +HNLFG  + V +  S G  S+ +   + G +  DVL  M+H+P+++ E L+  AE
Sbjct:  540 PYLIGLFLSGAYQEVMGNLHNLFGTTNAVHIRLSPG-GSYRIDHVVRGDTNADVLEAMEHDPRVLLERLRVAAE 612          

HSP 2 Score: 31.5722 bits (70), Expect = 6.423e-14
Identity = 14/25 (56.00%), Postives = 18/25 (72.00%), Query Frame = 3
Query:    3 CDSDGKIDKFIGGGTS---LPLHEM 68
            CDSDG++D+FIG G     L LHE+
Sbjct:  511 CDSDGRLDRFIGDGQPKQLLELHEL 535          
The following BLAST results are available for this feature:
BLAST of CK740118 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
SPE1_SOYBN7.757e-4585.37Arginine decarboxylase OS=Glycine max PE=2 SV=1[more]
SPE1_ARATH4.825e-4185.90Arginine decarboxylase 1 OS=Arabidopsis thaliana G... [more]
SPE2_ARATH8.190e-4180.23Arginine decarboxylase 2 OS=Arabidopsis thaliana G... [more]
SPE1_DIACA6.800e-4087.84Arginine decarboxylase OS=Dianthus caryophyllus GN... [more]
SPE1_BRAJU5.647e-3987.84Arginine decarboxylase OS=Brassica juncea GN=ADC1 ... [more]
SPE1_PEA3.569e-3687.50Arginine decarboxylase OS=Pisum sativum PE=2 SV=1[more]
SPE1_ORYSJ2.050e-3580.82Arginine decarboxylase OS=Oryza sativa subsp. japo... [more]
SPE1_SOLLC4.570e-2490.48Arginine decarboxylase OS=Solanum lycopersicum PE=... [more]
SPEA_SYNR35.766e-1641.03Biosynthetic arginine decarboxylase OS=Synechococc... [more]
SPEA_SYNPX6.423e-1440.54Biosynthetic arginine decarboxylase OS=Synechococc... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6612 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE65F05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740118 ID=CK740118|Name=CK740118|organism=Citrus sinensis|type=EST|length=444bp
CTTGTGATAGTGATGGTAAGATTGATAAGTTCATTGGTGGTGGTACGAGC
TTGCCGTTACATGAAATGGTTGGTGGTGGTTGTGGTGAGCCGTGGGCCTT
ATTATTTGGGGATGTTCTTGGGTGGGGCTTATGAGGAGGCCCTCGGTGGA
GTCCACAACTTGTTTGGTGGTCCAAGCGTGGTACGCGTCTTGCAGAGTGA
TGGTCCGCACAGCTTTGCTGTGACTCGGGCCATGCCTGGGCCGTCTTGTG
GGGATGTCCTCCGGGTGATGCAGCACGAGCCCCAGCTCATGTTTGAGACC
CTCAAACACCGTGCTGAGGAATATTGTGGACAGGAGCATGGTAGTAATGG
TGGGGATGGTGATACTGATGATTACCATCACGGCATGGCTAATAATTCTG
CTTTAGCTAGCAGCCTTGCTCAGTACTTTCACAGCATGCCATAT
back to top