CK740125

Overview
NameCK740125
Unique NameCK740125
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length700
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig305 contig Csv1_Contig305:152..852. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. japonica GN=SAP8 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.231e-62
Identity = 117/174 (67.24%), Postives = 136/174 (78.16%), Query Frame = 3
Query:   36 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            M+H ETGCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++KQ+QAKLAASSI SIVN     +G E + A   +V  + VE K +  QP+  +  SE V   PK  EGP+RCS+C+KRVGLTGF CRCGNLYC  HRYSDKH+C FDYRTAARDAI KANPV+KAEKLDKI
Sbjct:    1 MEHKETGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVN--GGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI 171          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSI (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. indica GN=SAP8 PE=2 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 1.231e-62
Identity = 117/174 (67.24%), Postives = 136/174 (78.16%), Query Frame = 3
Query:   36 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            M+H ETGCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++KQ+QAKLAASSI SIVN     +G E + A   +V  + VE K +  QP+  +  SE V   PK  EGP+RCS+C+KRVGLTGF CRCGNLYC  HRYSDKH+C FDYRTAARDAI KANPV+KAEKLDKI
Sbjct:    1 MEHKETGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVN--GGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI 171          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP4_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Oryza sativa subsp. japonica GN=SAP4 PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.966e-60
Identity = 112/174 (64.37%), Postives = 132/174 (75.86%), Query Frame = 3
Query:   36 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            M+H E GCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++K++QAKLAASSI SIVN           A+ +  V  + VE K + VQP+  +  SE V   PK  EGP+RC++C+KRVGLTGF CRCGN+YC  HRYSDKH C FDYRTAARDAI KANPV+KAEKLDKI
Sbjct:    1 MEHKEAGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKEEQAKLAASSIDSIVNGCDGGKEHIVAASGSTAVAVAQVEAKTLVVQPTDVAGTSEEVAVVPKVKEGPNRCATCRKRVGLTGFNCRCGNMYCALHRYSDKHECQFDYRTAARDAIAKANPVVKAEKLDKI 173          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP2_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 2 OS=Arabidopsis thaliana GN=SAP2 PE=2 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 2.657e-57
Identity = 108/178 (60.67%), Postives = 135/178 (75.84%), Query Frame = 3
Query:   36 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNG--SESVAAATVDVQASSVEPKIISVQPSCASELSESVE----AKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            MDHD+TGCQ+PPEGP LC NNCGFFGS ATMNMCSKC+KD++ +Q+Q    AS++      TSSS+    E+  AA VD++  SVEP  +SVQPS    ++E V     AKPK GPSRC++C KRVGLTGFKCRCG+L+C +HRY+D H+C F+Y  AA++AI KANPV+KAEKLDKI
Sbjct:    1 MDHDKTGCQSPPEGPKLCTNNCGFFGSAATMNMCSKCHKDMLFQQEQGAKFASAVSG----TSSSSNIIKETFTAALVDIETKSVEPMTVSVQPSSVQVVAEVVAPEEAAKPK-GPSRCTTCNKRVGLTGFKCRCGSLFCGTHRYADVHDCSFNYHAAAQEAIAKANPVVKAEKLDKI 173          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP6_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Arabidopsis thaliana GN=SAP6 PE=2 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 3.734e-35
Identity = 80/177 (45.20%), Postives = 112/177 (63.28%), Query Frame = 3
Query:   45 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSE--------SVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            +E  CQ P E   LC+NNCGF GS ATMN+CS CY D+ LKQ Q    +SSI S V E+S S    S +++ +   +S + P ++   PS   E+ E        + E   ++ P+RC++C+KRVGLTGFKCRCG ++C  HRY + H C +D+++A R+ I KANP++KA KL KI
Sbjct:    3 EEHRCQTP-ESNRLCVNNCGFLGSSATMNLCSNCYGDLCLKQQQQ---SSSIKSTV-ESSLSVSPPSSSSSEI---SSPIIPPLLK-NPSVKLEVPEKKAVISLPTTEQNQQQRPNRCTTCRKRVGLTGFKCRCGTMFCGVHRYPEIHGCSYDFKSAGREEIAKANPLVKAAKLQKI 170          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP7_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 7 OS=Arabidopsis thaliana GN=SAP7 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.419e-34
Identity = 66/165 (40.00%), Postives = 107/165 (64.85%), Query Frame = 3
Query:   66 PPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSC---ASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            PP  P LC N CGFFGS + MN+CSKCY+ +  ++DQ  +A +++ + +   S S  +       ++++ + +E  +++ +PS    A+E  E+  ++P    +RC SC K+VG+ GFKC+CG+ +C SHRY +KH C FD++   RDAI KANP++KA+K+ +I
Sbjct:   12 PPTEPKLCDNGCGFFGSPSNMNLCSKCYRSLRAEEDQTAVAKAAVKNSLKLPSCSIIAPG-QKHPLEIKPAHLETVVVTAEPSSVPVAAEQDEAEPSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANPLVKADKVQRI 175          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP9_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Oryza sativa subsp. japonica GN=SAP9 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.853e-34
Identity = 73/161 (45.34%), Postives = 99/161 (61.49%), Query Frame = 3
Query:   69 PEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            PE PILC+NNCGFFGS  T NMCSKCY+D +       +AA  +       +SS+ +    A   +V A++VE K  + +P             PK   +RC SC+K+VGLTGF+CRCG  +C +HRY++ H+C FDY+ A RD I K NPV+ AEK++KI
Sbjct:   17 PEAPILCVNNCGFFGSSMTNNMCSKCYRDFV---KVTTMAAPVVEKKAFTPASSSKTPLEPAKPDEVPAAAVEDKQAAQEP-------------PKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNPVVIAEKINKI 161          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP4_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Arabidopsis thaliana GN=SAP4 PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.420e-34
Identity = 72/169 (42.60%), Postives = 98/169 (57.99%), Query Frame = 3
Query:   45 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            +E  C+ P EG  LC+NNCGFFGS ATMN+CS CY D+ LKQ Q     S++ S ++   +       A   +     + E K I +            +  P + P+RC+ C+KRVGLTGF CRCG  +C SHRY + H C FD+++A R+ I KANP++ A KL KI
Sbjct:    3 EEHRCETP-EGHRLCVNNCGFFGSSATMNLCSNCYGDLCLKQQQQASMKSTVESSLSPVIAPVLENYAAELEIPTTKKTEEKKPIQIPTE---------QPSPPQRPNRCTVCRKRVGLTGFMCRCGTTFCGSHRYPEVHGCTFDFKSAGREEIAKANPLVIAAKLQKI 161          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP1_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Arabidopsis thaliana GN=SAP1 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.049e-33
Identity = 67/161 (41.61%), Postives = 93/161 (57.76%), Query Frame = 3
Query:   69 PEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            P  P LC+  CGFFGS + MN+CSKCY+DI   ++Q   A +++   +N        +     T  V  S           S A+ L       PK   +RC SC K+VG+TGFKCRCG+ +C +HRY + H C FD++  AR+AI KANPV+KA+K+D+I
Sbjct:   13 PSEPKLCVKGCGFFGSPSNMNLCSKCYRDIRATEEQTASAKAAVEKSLNPNKPKTQPQQSQEITQGVLGSGSSSSSTRGGDSAAAPLDP-----PKSTATRCLSCNKKVGVTGFKCRCGSTFCGTHRYPESHECQFDFKGVAREAIAKANPVVKADKVDRI 168          
BLAST of CK740125 vs. ExPASy Swiss-Prot
Match: SAP6_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Oryza sativa subsp. japonica GN=SAP6 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.785e-33
Identity = 72/169 (42.60%), Postives = 95/169 (56.21%), Query Frame = 3
Query:   45 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 551
            +ETG   P E PILC+NNCGFFGS  T NMCSKCY+D +         A ++ ++V +   ++ S +     V    S           S A       E  PK   +RC SC+K+VGLTGFKCRCG  +C  HRY+D H C FDY+   R+ I K NP++KA+K+ KI
Sbjct:   11 EETGVHTP-EAPILCVNNCGFFGSRMTENMCSKCYRDTV--------KAKTVATVVEKKPLASLSSTPLVTEVTDGGSG----------SVADGKQVMEEDTPKPPSNRCLSCRKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQVGREQIAKQNPLVKADKITKI 160          
The following BLAST results are available for this feature:
BLAST of CK740125 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
SAP8_ORYSJ1.231e-6267.24Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP8_ORYSI1.231e-6267.24Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ORYSJ1.966e-6064.37Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP2_ARATH2.657e-5760.67Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP6_ARATH3.734e-3545.20Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP7_ARATH1.419e-3440.00Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP9_ORYSJ1.853e-3445.34Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ARATH2.420e-3442.60Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP1_ARATH2.049e-3341.61Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP6_ORYSJ7.785e-3342.60Zinc finger A20 and AN1 domain-containing stress-a... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6619 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE65G02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740125 ID=CK740125|Name=CK740125|organism=Citrus sinensis|type=EST|length=700bp
CTGTTTCTTCTGTTGCTCGCAGGGGTGGTGAAAACATGGACCATGATGAG
ACTGGATGCCAAGCTCCTCCTGAGGGCCCTATCTTGTGCATCAACAATTG
TGGTTTCTTTGGAAGTGTGGCTACTATGAATATGTGTTCCAAATGCTACA
AGGATATAATGCTGAAACAGGATCAAGCTAAGCTTGCTGCTTCATCTATT
GGAAGCATTGTGAATGAAACGTCAAGCAGCAATGGAAGTGAATCTGTTGC
TGCTGCCACTGTTGATGTGCAAGCTAGTTCAGTGGAGCCAAAAATCATCT
CTGTGCAGCCATCATGTGCTTCAGAATTGAGCGAGAGTGTGGAGGCAAAG
CCGAAGGAGGGTCCCAGCCGGTGCAGCAGTTGCAAGAAGCGTGTTGGTTT
AACAGGATTCAAATGTCGCTGTGGTAACTTATACTGTGTGTCACATCGCT
ATTCGGACAAACATAACTGCCCCTTTGACTACCGCACTGCTGCTAGGGAT
GCTATAATTAAAGCAAACCCTGTGATCAAGGCTGAGAAGCTAGATAAAAT
CTAGATTCAATGGGATGAGGGTTCAATAATCAAAGAATGATGATCTTGCT
CATCTGTTAGAGGCTTCTTCTGAAAGGCCACGTATCTTATCAGGTGTCCT
TTAATGGTATATATGCTGGGGGCCCATTATCAGTTATAGGACATCTCTGC
back to top