CK740126

Overview
NameCK740126
Unique NameCK740126
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length708
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK740126_ssr568 microsatellite CK740126_ssr568:568..579. BLAST: Citrus ESTs to Prunus persica proteins V1
CK740126_ssr612 microsatellite CK740126_ssr612:612..623. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CK740126 vs. ExPASy Swiss-Prot
Match: GTE6_ARATH (Transcription factor GTE6 OS=Arabidopsis thaliana GN=GTE6 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.314e-36
Identity = 70/146 (47.95%), Postives = 92/146 (63.01%), Query Frame = 2
Query:  119 VHVMAKTLLAKFEEKWLQLLPKVTXXXXXXXXXXXXXQLDMQLAQDAAHAKMARDTSNELYEVDVHLDELREMLVQKCRKTSTEEKRKLGAALTRLSPEDLGKALEIVAQSNTGFQATAEEVELDMDAQSESTLWRVKFFVKDALN 556
            V+ MAK LL KFEEKW   LPKV                +  LA++A+H K  R+  NE+   +  L++L   +V++CRK + EEKR +G AL +LSP+DL K L IVAQ+N  FQ  AEEV ++MD   E TLWR+KFFVKDAL+
Sbjct:  180 VYSMAKKLLEKFEEKWAHFLPKVQEEEKIREEEEKQAAKEALLAKEASHIKTTRELGNEICHANDELEKLMRKVVERCRKITIEEKRNIGLALLKLSPDDLQKVLGIVAQANPSFQPRAEEVSIEMDILDEPTLWRLKFFVKDALD 325          

HSP 2 Score: 31.9574 bits (71), Expect = 5.314e-36
Identity = 13/18 (72.22%), Postives = 16/18 (88.89%), Query Frame = 1
Query:   64 DVRLVFKNAMKYNDERSD 117
            D+RLVF+NAM YN+E SD
Sbjct:  162 DMRLVFENAMNYNEETSD 179          

HSP 3 Score: 24.6386 bits (52), Expect = 5.314e-36
Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = 3
Query:    3 STIKKQMEAKE---YKNVREI 56
            STIK QMEAK+   YK+V +I
Sbjct:  139 STIKNQMEAKDGTGYKHVMQI 159          
The following BLAST results are available for this feature:
BLAST of CK740126 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
GTE6_ARATH5.314e-3647.95Transcription factor GTE6 OS=Arabidopsis thaliana ... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6620 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE65G03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740126 ID=CK740126|Name=CK740126|organism=Citrus sinensis|type=EST|length=708bp
TCAGTACAATAAAAAAACAAATGGAGGCCAAGGAATATAAGAACGTACGT
GAGATATGCACCTGATGTGAGGTTGGTTTTTAAGAATGCCATGAAATATA
ATGATGAAAGAAGTGACCGTTCATGTAATGGCAAAAACGTTGCTGGCAAA
ATTTGAGGAGAAGTGGTTGCAACTTCTGCCTAAAGTTACTGAAGAGGAAA
AAAGACGAGAAGAAGAGGAAGCAGAGGCACAGCTGGATATGCAGCTTGCT
CAGGATGCTGCTCATGCCAAAATGGCTAGAGATACAAGTAATGAGCTTTA
TGAGGTCGATGTGCATTTGGACGAACTCAGAGAAATGCTTGTTCAAAAGT
GCAGAAAAACTTCAACCGAAGAGAAAAGAAAGCTTGGTGCAGCACTTACC
AGATTGTCCCCCGAGGATCTCGGTAAAGCATTGGAGATTGTTGCTCAGAG
TAACACAGGCTTTCAAGCAACAGCTGAAGAGGTTGAACTTGATATGGATG
CTCAGAGTGAATCCACTTTATGGAGGGTGAAATTCTTCGTGAAAGATGCT
CTCAATCTCAGGGCAATAACAACAACAACGACAATAACAAAAACAACAAT
AACAGTGCCACCAACAACAACAAACGGAAGAGAGAGATTTGTGATGCCAT
TGCCAAACTGCCAAGAAAAAGAAACAAAGGCCTCTGCTTGATCATTTCAG
AACTTGCT
back to top