CK740127

Overview
NameCK740127
Unique NameCK740127
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length398
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1498 contig Csv1_Contig1498:192..589. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDK1_ARATH (Nucleoside diphosphate kinase 1 OS=Arabidopsis thaliana GN=NDPK1 PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 6.831e-57
Identity = 101/128 (78.91%), Postives = 114/128 (89.06%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            +I RFEKKGF+LKGLKL++V+R FAEKHYEDLSSK FF  L++YI SGPVVAMIWEG+ VV TGR IIGATNPA S PGTIRGD AI  GRN+IHGSDSVESA+KEIALWFPDGP+NWQSS+HPW+YE
Sbjct:   21 VICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYE 148          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDKB_FLABI (Nucleoside diphosphate kinase B OS=Flaveria bidentis PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 3.390e-56
Identity = 102/128 (79.69%), Postives = 113/128 (88.28%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGFSLKGLKL+TVD+ FAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+ VV TGR IIGATNPA+SAPGTIRGD AI  GRN+IHGSD+VESA+KEIALWFP+G  NW SSLHPWIYE
Sbjct:   21 IIGRFEKKGFSLKGLKLLTVDQAFAEKHYADLSAKPFFNGLVEYIISGPVVAMVWEGKNVVTTGRKIIGATNPAESAPGTIRGDFAIDIGRNVIHGSDAVESAKKEIALWFPEGVANWSSSLHPWIYE 148          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDKA_FLABI (Nucleoside diphosphate kinase A OS=Flaveria bidentis PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 7.552e-56
Identity = 102/128 (79.69%), Postives = 111/128 (86.72%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGFSLKGLKL+TVDR FAEKHY DLSSKPFF  L+EYI SGPVVAM+WEG+ VV TGR IIGATNPA+SAPGTIRGD AI  GRN+IHGSD+VESA+K I LWFP+G  NW SSLHPWIYE
Sbjct:   21 IIGRFEKKGFSLKGLKLLTVDRAFAEKHYADLSSKPFFNGLVEYIVSGPVVAMVWEGKNVVTTGREIIGATNPAESAPGTIRGDFAIDIGRNVIHGSDAVESARKVIGLWFPEGVANWSSSLHPWIYE 148          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDK1_TOBAC (Nucleoside diphosphate kinase 1 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.870e-55
Identity = 101/128 (78.91%), Postives = 112/128 (87.50%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGFSLKGLKL+TVDR FAEKHY DLS+KPFF  L++YI SGPVVAM+WEG+GVV TGR IIGATNP +SAPGTIRGD AI  GRN+IHGSD+VESA+KEIALWFP+G   WQSSLH WIYE
Sbjct:   21 IIGRFEKKGFSLKGLKLITVDRAFAEKHYSDLSAKPFFNGLVDYIISGPVVAMVWEGKGVVTTGRKIIGATNPLESAPGTIRGDYAIDIGRNVIHGSDAVESARKEIALWFPEGVAEWQSSLHSWIYE 148          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDK1_MESCR (Nucleoside diphosphate kinase 1 OS=Mesembryanthemum crystallinum GN=NDKP1 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 4.895e-55
Identity = 100/128 (78.12%), Postives = 109/128 (85.16%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGFSLK LK + VDRPFAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+GVV TGR IIGATNP  S PGTIRGD AI  GRN+IHGSD+VESA KEIALWFP+G +NWQSSLH WIYE
Sbjct:   21 IISRFEKKGFSLKALKFINVDRPFAEKHYADLSAKPFFNGLVEYIVSGPVVAMVWEGKGVVLTGRKIIGATNPLASEPGTIRGDFAIDIGRNVIHGSDAVESATKEIALWFPEGVVNWQSSLHSWIYE 148          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDK1_SOYBN (Nucleoside diphosphate kinase 1 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 6.393e-55
Identity = 102/128 (79.69%), Postives = 110/128 (85.94%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGF LKGLKL+TVDRPFAEKHY DLS+KPFF  L++YI SGPVVAMIWEG+ VV TGR IIGATNPAQS PGTIRGD AI  GRN+IHGSD+VESA KEIALWFP+GP N QSS H WIYE
Sbjct:   22 IISRFEKKGFYLKGLKLVTVDRPFAEKHYADLSAKPFFSGLVDYIISGPVVAMIWEGKNVVTTGRKIIGATNPAQSEPGTIRGDFAIDIGRNVIHGSDAVESANKEIALWFPEGPANCQSSQHSWIYE 149          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDK_HELAN (Nucleoside diphosphate kinase OS=Helianthus annuus PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 8.350e-55
Identity = 99/128 (77.34%), Postives = 111/128 (86.72%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGF+LKGLKL+TVD+ FAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+ VV TGR IIGATNPA+S PGTIRGD AI  GRN+IHGSD+VESA+KEI LWFP+G  NW SSLHPWIYE
Sbjct:   21 IIGRFEKKGFTLKGLKLLTVDQAFAEKHYADLSAKPFFNGLVEYIISGPVVAMVWEGKNVVTTGRKIIGATNPAESPPGTIRGDFAIDIGRNVIHGSDAVESAKKEIGLWFPEGVANWSSSLHPWIYE 148          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDK_CAPAN (Nucleoside diphosphate kinase OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.091e-54
Identity = 100/128 (78.12%), Postives = 112/128 (87.50%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGFSLKGLKL+TVDR FAEKHY DLS+KPFF  L+EYI SGPVV+M+WEG+GV+ TGR IIGATNP +SAPGTIRGD AI  GRN+IHGSD+VESA+KEIALWFP+G   WQSSLH WIYE
Sbjct:   21 IIGRFEKKGFSLKGLKLITVDRAFAEKHYADLSAKPFFNGLVEYIVSGPVVSMVWEGKGVLTTGRKIIGATNPLESAPGTIRGDYAIDIGRNVIHGSDAVESARKEIALWFPEGVAEWQSSLHCWIYE 148          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDK1_SPIOL (Nucleoside diphosphate kinase 1 OS=Spinacia oleracea GN=NDPK1 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.860e-54
Identity = 98/128 (76.56%), Postives = 109/128 (85.16%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGFSLK LK + VDRPFAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+GVV TGR +IGATNP  S PGTIRGD AI  GRN+IHGSD+V+SA KEIALWFPDG ++WQSSLH WIYE
Sbjct:   21 IISRFEKKGFSLKALKFVNVDRPFAEKHYADLSAKPFFNGLVEYIVSGPVVAMVWEGKGVVATGRKLIGATNPLASEPGTIRGDFAIDIGRNVIHGSDAVDSATKEIALWFPDGVVHWQSSLHSWIYE 148          
BLAST of CK740127 vs. ExPASy Swiss-Prot
Match: NDK_SOLLC (Nucleoside diphosphate kinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 2.057e-53
Identity = 100/128 (78.12%), Postives = 110/128 (85.94%), Query Frame = 1
Query:    1 IIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 384
            II RFEKKGFSLKGLKL+TVDR FAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+GVV TGR IIGATNP +SA GTIRGD AI  GRN+IHGSD+VESA+KEIALWFP+G   WQSSLH  IYE
Sbjct:   17 IISRFEKKGFSLKGLKLITVDRAFAEKHYADLSAKPFFNGLVEYIVSGPVVAMVWEGKGVVATGRKIIGATNPLESAAGTIRGDFAIDIGRNVIHGSDAVESARKEIALWFPEGIAEWQSSLHSCIYE 144          
The following BLAST results are available for this feature:
BLAST of CK740127 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
NDK1_ARATH6.831e-5778.91Nucleoside diphosphate kinase 1 OS=Arabidopsis tha... [more]
NDKB_FLABI3.390e-5679.69Nucleoside diphosphate kinase B OS=Flaveria bident... [more]
NDKA_FLABI7.552e-5679.69Nucleoside diphosphate kinase A OS=Flaveria bident... [more]
NDK1_TOBAC2.870e-5578.91Nucleoside diphosphate kinase 1 OS=Nicotiana tabac... [more]
NDK1_MESCR4.895e-5578.13Nucleoside diphosphate kinase 1 OS=Mesembryanthemu... [more]
NDK1_SOYBN6.393e-5579.69Nucleoside diphosphate kinase 1 OS=Glycine max PE=... [more]
NDK_HELAN8.350e-5577.34Nucleoside diphosphate kinase OS=Helianthus annuus... [more]
NDK_CAPAN1.091e-5478.13Nucleoside diphosphate kinase OS=Capsicum annuum P... [more]
NDK1_SPIOL1.860e-5476.56Nucleoside diphosphate kinase 1 OS=Spinacia olerac... [more]
NDK_SOLLC2.057e-5378.13Nucleoside diphosphate kinase (Fragment) OS=Solanu... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6621 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE6G04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740127 ID=CK740127|Name=CK740127|organism=Citrus sinensis|type=EST|length=398bp
ATCATCATCAGATTTGAGAAGAAGGGTTTCTCTTTGAAGGGTTTGAAGCT
TATGACTGTGGACCGCCCTTTTGCTGAGAAGCACTATGAGGATTTGTCAT
CGAAGCCTTTCTTTGGTTCTCTGATTGAGTACATTACCTCTGGTCCTGTT
GTTGCTATGATTTGGGAGGGTGAAGGTGTTGTTAAGACTGGCCGCACTAT
TATTGGAGCCACCAACCCTGCGCAGTCTGCTCCTGGAACCATCCGTGGTG
ATTTGGCTATCGTGACGGGCAGGAATATTATCCATGGAAGTGACTCAGTT
GAGAGTGCCCAGAAAGAAATCGCCTTGTGGTTCCCTGATGGCCCTATTAA
CTGGCAGAGCAGCCTTCACCCTTGGATCTATGAGTAAACTAATGTTTG
back to top