CK740128

Overview
NameCK740128
Unique NameCK740128
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length669
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12798 contig Csv1_Contig12798:267..935. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: PROSC_HUMAN (Proline synthetase co-transcribed bacterial homolog protein OS=Homo sapiens GN=PROSC PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.677e-47
Identity = 101/190 (53.16%), Postives = 135/190 (71.05%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQ-----LPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGR-KPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGM--PDYTSTPE-NFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 545
            ENYVQE++EKA+      L  +++WHFIG+LQ   V  L+A VPNL M+E+VD+ K+A ++N   +  G  + LKV+VQ+NTSGEESK G+ PS  + +V+H++  CPNLEF GLMTIG    D +  P  +F+ L   R E+CK L IP +Q +LSMGMS DF+ A+E+GSTNVRIGSTIFG R+Y KK
Sbjct:   67 ENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMA-VPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKK 255          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: PROSC_PONAB (Proline synthetase co-transcribed bacterial homolog protein OS=Pongo abelii GN=PROSC PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.525e-46
Identity = 101/190 (53.16%), Postives = 135/190 (71.05%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQ-----LPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGR-KPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGM--PDYTSTPE-NFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 545
            ENYVQE++EKA+      L  +++WHFIG+LQ   V  L+A VPNL ++E+VD+ K+AG++N   +  G  + LKV+VQ+NTSGEESK G+ PS  + +V+H++  CPNLEF GLMTIG    D +  P  +F+ L   R E+CK L IP +Q +LSMGMS DF+ AIE+GSTNVRIGS IFG R+Y KK
Sbjct:   67 ENYVQELLEKASNPKILSLGPEIKWHFIGHLQKQNVNKLMA-VPNLFVLETVDSVKLAGKVNSSWQKKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSVDFQHAIEVGSTNVRIGSMIFGERDYSKK 255          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: PROSC_MOUSE (Proline synthetase co-transcribed bacterial homolog protein OS=Mus musculus GN=Prosc PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.525e-46
Identity = 101/190 (53.16%), Postives = 137/190 (72.11%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQLP-----DDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMG-RKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGM--PDYTSTPE-NFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 545
            ENYVQE++EKA+         +++WHFIG+LQ   V  L+A VPNL+M+E+VD+ K+A ++N   +  G  +PLKV+VQ+NTSGE+SK G+ PS  + +V+H+  +CP+LEF GLMTIG    D +  P  +F+ L   R E+C+ LGIP EQ +LSMGMS DF+ AIE+GSTNVRIGSTIFG R+Y KK
Sbjct:   67 ENYVQELLEKASNPKILSSCPEIKWHFIGHLQKQNVNKLMA-VPNLSMLETVDSVKLADKVNSSWQKKGPTEPLKVMVQINTSGEDSKHGLLPSETIAVVEHIKASCPSLEFVGLMTIGSFGHDLSQGPNPDFQRLLTLRRELCEKLGIPVEQVELSMGMSMDFQHAIEVGSTNVRIGSTIFGERDYSKK 255          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: PROSC_BOVIN (Proline synthetase co-transcribed bacterial homolog protein OS=Bos taurus GN=PROSC PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 8.121e-45
Identity = 99/190 (52.11%), Postives = 133/190 (70.00%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQLP-----DDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGR-KPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGM--PDYTSTPE-NFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 545
            ENYVQE++EKA+         +++WHFIG+LQ   V  L+A VPNL+M+E+VD+ K+A ++N   +  G  + LKV+VQ+NTSGE SK G+ P+    LV+H++  CP+LEF GLMTIG    D +  P  +F+ L   R E+C+ LG P EQ +LSMGMS DF+ AIE+GSTNVRIGSTIFG R+Y KK
Sbjct:   67 ENYVQELLEKASNPQILSSCPEIKWHFIGHLQKQNVNKLMA-VPNLSMLETVDSVKLADKVNSAWQKKGSPERLKVMVQINTSGEASKHGLPPAEMAALVEHINAKCPSLEFVGLMTIGSFGHDLSQGPNPDFQVLLSLREELCRKLGAPPEQVELSMGMSVDFQHAIEVGSTNVRIGSTIFGERDYSKK 255          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: PROSC_DICDI (Proline synthetase co-transcribed bacterial homolog protein OS=Dictyostelium discoideum GN=prosc PE=3 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 8.979e-44
Identity = 97/196 (49.49%), Postives = 129/196 (65.82%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQLPD--DLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRL----------NRMVETMGRKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQ--NCPN-LEFCGLMTIGMPDYTSTPENFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 545
            ENY+QE+V K+ +L +  +++WHFIG++QSNK K +L  V NL +VE+V+N+KI  +L          N        K L +++QVNTSGEESKSG +P  CL+LVKH  +  NC N L F GLMTIG P+ T    +FK L  C++ + K L IP +  +LSMGMS DFE AIE GST+VR+GS IFG R+Y  K
Sbjct:   60 ENYIQELVSKSEELSELNEIKWHFIGSIQSNKSK-ILTSVKNLYVVETVENKKILDKLAKSLLNNEENNNNNNNNNNKKLNIMIQVNTSGEESKSGCKPEECLDLVKHCLEDNNCKNSLNFLGLMTIGNPNATPDQPDFKCLVDCKNNISKQLNIPLDSIELSMGMSHDFEPAIEFGSTSVRVGSAIFGERDYSNK 254          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: YKC9_SCHPO (UPF0001 protein C644.09 OS=Schizosaccharomyces pombe GN=SPAC644.09 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.781e-34
Identity = 87/183 (47.54%), Postives = 117/183 (63.93%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQLPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGRKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGMPDYTSTPE---NFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPK 542
            ENY+QE ++K   +PDD++WHFIG+LQS+K K  +A V NL  +E++D EK A  +N   E + + PL V +QVNTSGEE+K GV PS  LEL K V Q+   L   GLMTIG    +   +   +F+ L+  R  +   LGIP     LSMGMS D+ LAI+ GS +VR+GS+IFG+R   K
Sbjct:   51 ENYMQEFLKKVELMPDDVQWHFIGSLQSSKCKK-IASVKNLYSIETIDTEKKARLVNSAREAL-QLPLNVYIQVNTSGEENKGGVTPSKVLELCKQV-QDMKYLRLKGLMTIGSISNSQLSDHNPDFQVLSDLRESLQNELGIP---LQLSMGMSSDYLLAIKYGSDSVRVGSSIFGSRPTEK 227          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: PROSC_CAEEL (Proline synthetase co-transcribed bacterial homolog protein OS=Caenorhabditis elegans GN=F09E5.8 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.030e-31
Identity = 84/189 (44.44%), Postives = 114/189 (60.32%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQLPD---DLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGRK--PLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGMPDYT-STPEN--FKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 545
            ENYVQE+ EK+  L     D+ WHFIG +QSNK+  +    P L  VE+V+ EK A   ++     G    PL+VLVQVNTSGE++K G+E     +L + + + C NL+F G MTIG  D + ++ EN  F+ L K R    +  G   +  +LSMGMS DF  AI  G+T+VR+GS +FGAREY  K
Sbjct:   57 ENYVQELEEKSDVLASKCLDIRWHFIGQVQSNKIGKI-CNSPGLWCVETVETEKHARIFDKEWSKHGANLSPLRVLVQVNTSGEDNKGGIEIGEAPKLAEFIRKECQNLKFDGFMTIGSFDNSHASGENPDFEKLFKVRQTWAEQTGESADSVELSMGMSDDFLQAIHQGATSVRVGSKLFGAREYKNK 244          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: Y112_PASMU (UPF0001 protein PM0112 OS=Pasteurella multocida GN=PM0112 PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 9.638e-30
Identity = 86/186 (46.24%), Postives = 114/186 (61.29%), Query Frame = 3
Query:    3 ENYVQEIVEKA---AQLPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGRKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGMP--DYTSTPENFKTLAKCRSEVCKALGIPEEQCD-LSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPK 542
            ENYVQE VEK    AQ    LEWHFIG LQSNK K +     +   ++++D +KIA RLN       +KPL VL+Q+N S E+SKSG++P+  L+L K + QN P+L   GLM I  P  D  +  + F  +     ++ +AL  P+ Q D LSMGM+ D   AI+ GST VRIG+ IFGAR+Y K
Sbjct:   55 ENYVQEGVEKIQYFAQKNIPLEWHFIGPLQSNKTKLV---AEHFDWMQTLDRKKIADRLNEQ-RPHYKKPLNVLIQINISDEDSKSGIQPNEMLDLAKQI-QNLPHLCLRGLMAIPAPTDDLATQEQAFTQMHSLFEQLKQAL--PDAQIDTLSMGMTDDMASAIQCGSTMVRIGTAIFGARDYSK 233          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: Y461_VIBCH (UPF0001 protein VC_0461 OS=Vibrio cholerae GN=VC_0461 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.147e-29
Identity = 85/188 (45.21%), Postives = 112/188 (59.57%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQLPDD-----LEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGRKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTI--GMPDYTSTPENFKTLAKCRSEVCKALGIPEEQCD-LSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPK 542
            ENYVQE V+K     +      LEWHFIG LQSNK + +     +   V ++D EKIA RL+     +   PL+VL+QVNTSGE SKSG+EP     L + +S+  PNL   GLM+I   +PDY +    F  LA+ + ++ +       Q D LSMGMSGD + AIE GST VRIG+ IFG R+Y +
Sbjct:   56 ENYVQEGVDKIRYFAEHHPQLALEWHFIGPLQSNKTRLV---AEHFDWVHTIDREKIALRLSEQ-RPVNMPPLQVLIQVNTSGEASKSGIEPQQLFTLAELISR-LPNLTLRGLMSIPENVPDYPAQLAAFTQLAELQQQLAQKY----PQIDTLSMGMSGDMQAAIEAGSTIVRIGTAIFGERDYSR 234          
BLAST of CK740128 vs. ExPASy Swiss-Prot
Match: YBD6_YEAST (UPF0001 protein YBL036C OS=Saccharomyces cerevisiae GN=YBL036C PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.066e-28
Identity = 85/190 (44.74%), Postives = 113/190 (59.47%), Query Frame = 3
Query:    3 ENYVQEIVEKAAQLPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLN--RMVETMGRKPLKVLVQVNTSGEESKSGV-EPSGCLELVK-HVSQNCPNLEFCGLMTIGM--PDYTSTPEN--FKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKN 548
            ENYVQE++EKA  LPDD++WHFIG LQ+NK K  LA VPNL  VE++D+ K A +LN  R        P+   VQ+NTS E+ KSG+   +   E++   +S+ C  ++  GLMTIG     +  + EN  F TL + + ++    G       LSMGMS DF  AI  G+  VRIG+ IFGAR  P KN
Sbjct:   69 ENYVQELIEKAKLLPDDIKWHFIGGLQTNKCKD-LAKVPNLYSVETIDSLKKAKKLNESRAKFQPDCNPILCNVQINTSHEDQKSGLNNEAEIFEVIDFFLSEECKYIKLNGLMTIGSWNVSHEDSKENRDFATLVEWKKKIDAKFG---TSLKLSMGMSADFREAIRQGTAEVRIGTDIFGAR--PPKN 252          
The following BLAST results are available for this feature:
BLAST of CK740128 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
PROSC_HUMAN8.677e-4753.16Proline synthetase co-transcribed bacterial homolo... [more]
PROSC_PONAB2.525e-4653.16Proline synthetase co-transcribed bacterial homolo... [more]
PROSC_MOUSE2.525e-4653.16Proline synthetase co-transcribed bacterial homolo... [more]
PROSC_BOVIN8.121e-4552.11Proline synthetase co-transcribed bacterial homolo... [more]
PROSC_DICDI8.979e-4449.49Proline synthetase co-transcribed bacterial homolo... [more]
YKC9_SCHPO3.781e-3447.54UPF0001 protein C644.09 OS=Schizosaccharomyces pom... [more]
PROSC_CAEEL1.030e-3144.44Proline synthetase co-transcribed bacterial homolo... [more]
Y112_PASMU9.638e-3046.24UPF0001 protein PM0112 OS=Pasteurella multocida GN... [more]
Y461_VIBCH2.147e-2945.21UPF0001 protein VC_0461 OS=Vibrio cholerae GN=VC_0... [more]
YBD6_YEAST1.066e-2844.74UPF0001 protein YBL036C OS=Saccharomyces cerevisia... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6622 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE65G06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740128 ID=CK740128|Name=CK740128|organism=Citrus sinensis|type=EST|length=669bp
GTGAAAACTACGTTCAAGAAATAGTGGAAAAGGCGGCTCAGCTTCCAGAT
GATCTAGAATGGCATTTCATTGGGAACCTGCAGAGCAATAAAGTGAAACC
TTTATTGGCTGGTGTGCCTAACCTGGCAATGGTAGAAAGTGTGGACAACG
AGAAGATTGCAGGTCGTCTTAATCGTATGGTTGAAACCATGGGAAGGAAG
CCTTTAAAAGTCTTGGTTCAAGTGAATACCAGTGGAGAAGAATCGAAATC
TGGAGTTGAGCCTTCAGGGTGTCTGGAACTTGTGAAACATGTTAGTCAAA
ACTGTCCGAATCTTGAGTTTTGTGGCCTAATGACAATTGGGATGCCAGAT
TACACATCGACCCCGGAGAACTTCAAGACATTAGCAAAATGCAGAAGTGA
GGTATGCAAGGCTCTTGGAATACCAGAAGAGCAATGTGATCTGTCTATGG
GAATGTCTGGTGACTTCGAGCTTGCTATTGAAATGGGGAGCACCAATGTC
AGGATTGGATCCACAATATTTGGTGCAAGGGAATATCCGAAGAAGAACTA
AACTTTTTTTTTCACCTGTTCTGAAAACGTTGGCTATTGGTATGTATTTA
TCTTAATGTACTGAAACTAGAGTATAGTAGATTAATCATATTTTTTATGC
ACTTGTTCAAAAAAAAAAA
back to top