CK740129

Overview
NameCK740129
Unique NameCK740129
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length574
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9730 contig Csv1_Contig9730:351..923. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP28_ARATH (Probable aquaporin PIP2-8 OS=Arabidopsis thaliana GN=PIP2-8 PE=1 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 6.856e-97
Identity = 161/172 (93.60%), Postives = 164/172 (95.35%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPF 516
            WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL RAVAYMVAQCLGAICGVGLVKAFM   Y  LGGGANTVA GY+ G+ALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDDHWIFWVGPF
Sbjct:   76 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPF 247          

HSP 2 Score: 44.2838 bits (103), Expect = 6.856e-97
Identity = 21/21 (100.00%), Postives = 21/21 (100.00%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAAI 574
            PFVGALAAAAYHQYILRAAAI
Sbjct:  246 PFVGALAAAAYHQYILRAAAI 266          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP27_ARATH (Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2)

HSP 1 Score: 333.183 bits (853), Expect = 8.944e-97
Identity = 158/172 (91.86%), Postives = 166/172 (96.51%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPF 516
            WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ YM+AQCLGAICGVG VKAFMK  YN+LGGGANTVA GY+KG+ALGAEIIGTFVLVYTVFSATDPKRSARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDD WIFWVGPF
Sbjct:   78 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPF 249          

HSP 2 Score: 41.9726 bits (97), Expect = 8.944e-97
Identity = 19/21 (90.48%), Postives = 21/21 (100.00%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAAI 574
            PF+GALAAAAYHQYILRA+AI
Sbjct:  248 PFLGALAAAAYHQYILRASAI 268          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP1_ATRCA (Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.824e-94
Identity = 152/172 (88.37%), Postives = 161/172 (93.60%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPF 516
            W+FGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ YM+AQC GAICGVGLVKAFMK  YN  GGGAN+VA GYNKG+A GAE+IGTFVLVYTVFSATDPKRSARDSHVP+LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  + WDDHWIFWVGPF
Sbjct:   80 WSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLLRALVYMIAQCAGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTAFGAELIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKKRVWDDHWIFWVGPF 251          

HSP 2 Score: 43.8986 bits (102), Expect = 1.824e-94
Identity = 20/21 (95.24%), Postives = 21/21 (100.00%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAAI 574
            PFVGALAAAAYHQY+LRAAAI
Sbjct:  250 PFVGALAAAAYHQYVLRAAAI 270          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP26_ORYSJ (Probable aquaporin PIP2-6 OS=Oryza sativa subsp. japonica GN=PIP2-6 PE=2 SV=2)

HSP 1 Score: 315.079 bits (806), Expect = 6.327e-92
Identity = 150/172 (87.21%), Postives = 159/172 (92.44%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPF 516
            WAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVS+IRAV Y+VAQCLG I GVG+VK  MKH+YN+ GGGAN VASGY+ G+ALGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYN  KAWDDHWIFW GPF
Sbjct:   80 WAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVSVIRAVMYIVAQCLGGIVGVGIVKGIMKHQYNANGGGANMVASGYSTGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVIYNQKKAWDDHWIFWAGPF 251          

HSP 2 Score: 43.8986 bits (102), Expect = 6.327e-92
Identity = 20/21 (95.24%), Postives = 21/21 (100.00%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAAI 574
            PF+GALAAAAYHQYILRAAAI
Sbjct:  250 PFIGALAAAAYHQYILRAAAI 270          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP27_MAIZE (Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 7.572e-90
Identity = 147/172 (85.47%), Postives = 157/172 (91.28%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPF 516
            WAFGGMIF+LVYCTAGISGGHINPAVTFGLFL RKVSL+RA+ YM+AQC GAICG GL K F K  YN  GGG NTV+ GYNKG+ALGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG AVI+NNDKAWDD WI+WVGPF
Sbjct:   87 WAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPF 258          

HSP 2 Score: 36.1946 bits (82), Expect = 7.572e-90
Identity = 16/21 (76.19%), Postives = 17/21 (80.95%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAAI 574
            PFVGA  AA YHQYILR +AI
Sbjct:  257 PFVGAAVAAIYHQYILRGSAI 277          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP21_ORYSJ (Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 1.681e-89
Identity = 148/172 (86.05%), Postives = 161/172 (93.60%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPF 516
            WAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGVGLVKAF    +N  GGGANT+A+GY+KG+ L AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+NN+KAW +HWIFWVGPF
Sbjct:   90 WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVIFNNEKAWHNHWIFWVGPF 261          

HSP 2 Score: 36.5798 bits (83), Expect = 1.681e-89
Identity = 17/21 (80.95%), Postives = 17/21 (80.95%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAAI 574
            PFVGA  AA YHQYILRA AI
Sbjct:  260 PFVGAAIAAFYHQYILRAGAI 280          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP25_MAIZE (Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 2.193e-89
Identity = 148/172 (86.05%), Postives = 159/172 (92.44%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPF 516
            WAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGVGLVK F    Y   GGGAN +++GY+KG+ L AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYNNDKAWDDHWIFWVGPF
Sbjct:   85 WAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWDDHWIFWVGPF 256          

HSP 2 Score: 36.965 bits (84), Expect = 2.193e-89
Identity = 15/20 (75.00%), Postives = 18/20 (90.00%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAA 571
            PF+GA  AAAYHQY+LRA+A
Sbjct:  255 PFIGAAIAAAYHQYVLRASA 274          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 313.538 bits (802), Expect = 1.409e-88
Identity = 148/171 (86.55%), Postives = 160/171 (93.57%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGP 513
            WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGVGLVKAF    ++  GGGAN++ASGY++G+ LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIYN DK WDDHWIFWVGP
Sbjct:   90 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGP 260          

HSP 2 Score: 34.2686 bits (77), Expect = 1.409e-88
Identity = 16/21 (76.19%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAAI 574
            P VGA  AA YHQYILRA AI
Sbjct:  260 PLVGAAIAAFYHQYILRAGAI 280          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 1.410e-88
Identity = 151/172 (87.79%), Postives = 157/172 (91.28%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPF 516
            WAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLIRAV YMVAQCLGAICGVG VKAF    Y+  GGGAN++A GYN G+ L AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  K WDDHWIFWVGPF
Sbjct:   83 WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPF 254          

HSP 2 Score: 31.5722 bits (70), Expect = 1.410e-88
Identity = 12/19 (63.16%), Postives = 16/19 (84.21%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAA 568
            PF+GA  AA YHQ++LRA+
Sbjct:  253 PFIGAAIAAFYHQFVLRAS 271          
BLAST of CK740129 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 1.839e-88
Identity = 149/171 (87.13%), Postives = 155/171 (90.64%), Query Frame = 1
Query:    1 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGP 513
            WAFGGMIFVLVYCTAGISGGHINPAVT GLFLARKVSL+R V Y+VAQCLGAICG G VKAF    Y   GGGAN +A GYNKG+ LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDD WIFWVGP
Sbjct:   85 WAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGP 255          

HSP 2 Score: 35.8094 bits (81), Expect = 1.839e-88
Identity = 16/21 (76.19%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  512 PFVGALAAAAYHQYILRAAAI 574
            P +GA AAA YHQ+ILRAAAI
Sbjct:  255 PMIGAAAAAFYHQFILRAAAI 275          
The following BLAST results are available for this feature:
BLAST of CK740129 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 187
Match NameE-valueIdentityDescription
PIP28_ARATH6.856e-9793.60Probable aquaporin PIP2-8 OS=Arabidopsis thaliana ... [more]
PIP27_ARATH8.944e-9791.86Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7... [more]
PIP1_ATRCA1.824e-9488.37Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1[more]
PIP26_ORYSJ6.327e-9287.21Probable aquaporin PIP2-6 OS=Oryza sativa subsp. j... [more]
PIP27_MAIZE7.572e-9085.47Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1[more]
PIP21_ORYSJ1.681e-8986.05Probable aquaporin PIP2-1 OS=Oryza sativa subsp. j... [more]
PIP25_MAIZE2.193e-8986.05Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1[more]
PIP21_MAIZE1.409e-8886.55Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP22_ARATH1.410e-8887.79Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2... [more]
PIP24_ARATH1.839e-8887.13Probable aquaporin PIP2-4 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6623 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE65G08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740129 ID=CK740129|Name=CK740129|organism=Citrus sinensis|type=EST|length=574bp
TGGGCCTTTGGTGGCATGATCTTCGTCCTTGTTTACTGCACCGCTGGCAT
TTCTGGTGGTCACATTAACCCTGCTGTGACGTTTGGGCTGTTCTTGGCAA
GGAAGGTATCATTGATCAGGGCTGTGGCTTACATGGTGGCTCAGTGCTTG
GGTGCCATTTGCGGTGTTGGTTTGGTCAAGGCCTTCATGAAGCATGAGTA
CAACTCACTTGGTGGTGGTGCTAACACTGTGGCTTCTGGCTACAACAAAG
GATCAGCCTTGGGTGCTGAGATTATTGGTACCTTCGTGCTTGTTTACACA
GTCTTCTCGGCCACAGACCCCAAGAGAAGCGCTCGTGACTCTCACGTGCC
CGTTTTGGCTCCACTTCCAATTGGATTTGCTGTGTTCATGGTTCACTTGG
CCACCATCCCCATCACTGGAACGGGCATCAACCCTGCTAGGAGCTTTGGT
GCTGCTGTTATCTACAACAATGACAAGGCCTGGGATGACCATTGGATCTT
CTGGGTTGGTCCCTTTCGTTGGAGCATTGGCTGCAGCGGCATACCACCAG
TACATCTTGAGGGCTGCTGCTATC
back to top