CK740311

Overview
NameCK740311
Unique NameCK740311
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length550
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12466 contig Csv1_Contig12466:632..1180. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 7.470e-94
Identity = 145/152 (95.39%), Postives = 147/152 (96.71%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWIS 549
            REAADII+KGKMCCL INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNVADDDIVKLVDTFPGQSIDFFGALRARVY DEVR W+S
Sbjct:  211 REAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYHDEVRKWVS 362          

HSP 2 Score: 63.1586 bits (152), Expect = 7.470e-94
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  181 KMGINPIMMSAGELESGNAGEPAKLIRQRY 210          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA_ORYSJ (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Oryza sativa subsp. japonica GN=RCA PE=1 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 4.030e-92
Identity = 139/152 (91.45%), Postives = 147/152 (96.71%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWIS 549
            REAADII+KGKMCCL INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKE+NPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTR+DR+GVCKGIFR DNV D+DIVK+VD+FPGQSIDFFGALRARVYDDEVR W+S
Sbjct:  202 REAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEDNPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTRDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARVYDDEVRKWVS 353          

HSP 2 Score: 63.1586 bits (152), Expect = 4.030e-92
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  172 KMGINPIMMSAGELESGNAGEPAKLIRQRY 201          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 4.032e-92
Identity = 141/152 (92.76%), Postives = 146/152 (96.05%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWIS 549
            REAADII+KGKMCCL INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV ++DIVK+VD FPGQSIDFFGALRARVYDDEVR W+S
Sbjct:  211 REAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEDIVKVVDQFPGQSIDFFGALRARVYDDEVRKWVS 362          

HSP 2 Score: 63.1586 bits (152), Expect = 4.032e-92
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  181 KMGINPIMMSAGELESGNAGEPAKLIRQRY 210          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 8.212e-90
Identity = 142/152 (93.42%), Postives = 146/152 (96.05%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWIS 549
            REAADIIRKGKMC L INDLDAGAGR+GGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIFR+DNVA +DIVKLVDTFPGQSIDFFGALRARVYDDEVR WI+
Sbjct:  211 REAADIIRKGKMCALFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWIT 362          

HSP 2 Score: 58.151 bits (139), Expect = 8.212e-90
Identity = 28/30 (93.33%), Postives = 29/30 (96.67%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KM I+PIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  181 KMRISPIMMSAGELESGNAGEPAKLIRQRY 210          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA_CUCSA (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 1.398e-89
Identity = 137/150 (91.33%), Postives = 142/150 (94.67%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNW 543
            REAADII+KGKMCCL INDLDAGAGR+GGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRM+KFYWAPTREDRIG+C GIFR D V  +DIVKLVDTFPGQSIDFFGALRARVYDDEVR W
Sbjct:  208 REAADIIKKGKMCCLFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMDKFYWAPTREDRIGICTGIFRTDGVPFEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKW 357          

HSP 2 Score: 63.1586 bits (152), Expect = 1.398e-89
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  178 KMGINPIMMSAGELESGNAGEPAKLIRQRY 207          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA_SOLPN (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 1.822e-89
Identity = 136/152 (89.47%), Postives = 144/152 (94.74%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWIS 549
            REAA+IIRKG MCCL INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNK+EN RVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV ++ +VK+VD+FPGQSIDFFGALRARVYDDEVR W+S
Sbjct:  210 REAAEIIRKGNMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKQENARVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEAVVKIVDSFPGQSIDFFGALRARVYDDEVRKWVS 361          

HSP 2 Score: 63.1586 bits (152), Expect = 1.822e-89
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  180 KMGINPIMMSAGELESGNAGEPAKLIRQRY 209          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA2_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Nicotiana tabacum GN=RCA PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 2.378e-89
Identity = 135/152 (88.82%), Postives = 144/152 (94.74%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWIS 549
            REAA+IIRKG +CCL INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNK+EN RVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV ++ ++K+VDTFPGQSIDFFGALRARVYDDEVR W+S
Sbjct:  215 REAAEIIRKGNICCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKQENARVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEAVIKIVDTFPGQSIDFFGALRARVYDDEVRKWVS 366          

HSP 2 Score: 63.1586 bits (152), Expect = 2.378e-89
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  185 KMGINPIMMSAGELESGNAGEPAKLIRQRY 214          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA1_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 4.047e-89
Identity = 136/152 (89.47%), Postives = 142/152 (93.42%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWIS 549
            REAA+IIRKG MCCL INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNK+EN RVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIFR DNV  +D+VK+VD FPGQSIDFFGALRARVYDDEVR W+S
Sbjct:  215 REAAEIIRKGNMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKQENARVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCTGIFRTDNVPAEDVVKIVDNFPGQSIDFFGALRARVYDDEVRKWVS 366          

HSP 2 Score: 63.1586 bits (152), Expect = 4.047e-89
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  185 KMGINPIMMSAGELESGNAGEPAKLIRQRY 214          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 285.034 bits (728), Expect = 8.983e-89
Identity = 136/152 (89.47%), Postives = 142/152 (93.42%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWIS 549
            REAAD+I KGKMC L INDLDAGAGR+GGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEEN RVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTR+DR+GVCKGIFR D V ++DI KLVDTFPGQSIDFFGALRARVYDDEVR WIS
Sbjct:  213 REAADLIAKGKMCALFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENARVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTRDDRVGVCKGIFRTDGVPEEDITKLVDTFPGQSIDFFGALRARVYDDEVRKWIS 364          

HSP 2 Score: 63.1586 bits (152), Expect = 8.983e-89
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGNAGEPAKLIRQRY
Sbjct:  183 KMGINPIMMSAGELESGNAGEPAKLIRQRY 212          
BLAST of CK740311 vs. ExPASy Swiss-Prot
Match: RCAB_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic OS=Hordeum vulgare GN=RCAB PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 8.985e-89
Identity = 139/151 (92.05%), Postives = 143/151 (94.70%), Query Frame = 1
Query:   94 REAADIIRKGKMCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWI 546
            REAADII KGKMCCL INDLDAGAGRMGGTTQYTVNNQMVNATLMNIAD PT VQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV D+ +V+LVDTFPGQSIDFFGALRARVYDDEVR W+
Sbjct:  198 REAADIINKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADAPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPDEAVVRLVDTFPGQSIDFFGALRARVYDDEVRKWV 348          

HSP 2 Score: 56.9954 bits (136), Expect = 8.985e-89
Identity = 29/30 (96.67%), Postives = 29/30 (96.67%), Query Frame = 3
Query:    3 KMGINPIMMSAGELESGNAGEPAKLIRQRY 92
            KMGINPIMMSAGELESGN GEPAKLIRQRY
Sbjct:  169 KMGINPIMMSAGELESGN-GEPAKLIRQRY 197          
The following BLAST results are available for this feature:
BLAST of CK740311 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
RCA1_LARTR7.470e-9495.39Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ORYSJ4.030e-9291.45Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR4.032e-9292.76Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO8.212e-9093.42Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_CUCSA1.398e-8991.33Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SOLPN1.822e-8989.47Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_TOBAC2.378e-8988.82Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_TOBAC4.047e-8989.47Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU8.983e-8989.47Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAB_HORVU8.985e-8992.05Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6455 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63G01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740311 ID=CK740311|Name=CK740311|organism=Citrus sinensis|type=EST|length=550bp
CCAAGATGGGCATCAACCCAATTATGATGAGTGCCGGAGAATTGGAAAGT
GGCAATGCTGGAGAACCCGCTAAGTTGATCAGGCAGAGGTACCCGTGAGG
CAGCTGACATTATCAGGAAGGGAAAAATGTGCTGCCTCATGATCAATGAT
CTTGATGCAGGAGCTGGTCGTATGGGTGGCACCACCCAGTACACAGTTAA
CAACCAAATGGTTAACGCCACACTCATGAACATTGCTGATAACCCAACTT
GTGTCCAACTCCCTGGTATGTACAACAAGGAGGAGAACCCCCGTGTCCCA
ATCATAGTCACCGGTAATGACTTCTCAACATTGTATGCTCCTCTCATCCG
TGATGGTCGTATGGAGAAATTCTACTGGGCACCTACAAGGGAGGACCGTA
TTGGTGTGTGCAAGGGTATCTTCAGGAATGACAATGTGGCTGATGACGAC
ATTGTCAAGCTTGTTGACACCTTCCCCGGCCAATCCATTGATTTCTTTGG
AGCCCTGAGGGCCAGAGTCTATGATGATGAGGTGAGGAATTGGATCTCTG
back to top