CK740321

Overview
NameCK740321
Unique NameCK740321
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length333
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK740321 vs. ExPASy Swiss-Prot
Match: XTH1_SOLLC (Probable xyloglucan endotransglucosylase/hydrolase 1 OS=Solanum lycopersicum GN=XTH1 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.486e-11
Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 1
Query:    1 LRWVRQKYTIYNYCNDRARFPTPSPECKRDRDI 99
            LRWVRQKYT+YNYC D+AR+P P PEC +DRDI
Sbjct:  264 LRWVRQKYTVYNYCTDKARYPVPPPECTKDRDI 296          
BLAST of CK740321 vs. ExPASy Swiss-Prot
Match: XTH5_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 5 OS=Arabidopsis thaliana GN=XTH5 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.777e-11
Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 1
Query:    1 LRWVRQKYTIYNYCNDRARFPTPSPECKRDRDI 99
            L+WVR++YTIYNYC DR RFP P PEC+RDRDI
Sbjct:  261 LKWVRKRYTIYNYCTDRVRFPVPPPECRRDRDI 293          
The following BLAST results are available for this feature:
BLAST of CK740321 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
XTH1_SOLLC7.486e-1175.76Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH5_ARATH9.777e-1175.76Probable xyloglucan endotransglucosylase/hydrolase... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6465 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740321 ID=CK740321|Name=CK740321|organism=Citrus sinensis|type=EST|length=333bp
CTCAGATGGGTTCGCCAGAAATACACCATCTATAACTACTGCAACGATCG
TGCCCGCTTCCCTACGCCTTCACCAGAATGCAAACGAGACCGTGACATTT
AAGCGTCAATCTGAGATTCGCTCTGTGTGTGTACCAAGTATCTTAGTATG
CCTTTACCATTTATATTTATCAGAGGTATTGAAACAGGGCATGGGAGAGT
GTATGTATCCATTTTACTTGCGTTCTTCATTCATATTGGTGCTGCTTATT
CTTATATGTATTTTTTATCAAACCCTATTCGGGATGCATGGCAATAGAAA
GTTTATGGGTAAGGGTTGAAAAAAAAAAAAAAA
back to top