CK740322

Overview
NameCK740322
Unique NameCK740322
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length605
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12716 contig Csv1_Contig12716:258..861. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740322 vs. ExPASy Swiss-Prot
Match: OLEE1_BETVE (Olee1-like protein OS=Betula verrucosa PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.866e-15
Identity = 32/77 (41.56%), Postives = 48/77 (62.34%), Query Frame = 2
Query:   92 GTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPG---RERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVLR 313
            GTY+I V  DH++++C+  L  S   DC  V+     ++ +R+ LT  NGIS+  R AN +GFMK +P+  CA+ LR
Sbjct:   79 GTYRIPVDGDHEEEICEIALKKSSDPDCSEVSKDPFLKKSARISLTKNNGISTPVRLANPLGFMKKKPLPECAKALR 155          

HSP 2 Score: 33.4982 bits (75), Expect = 6.866e-15
Identity = 12/30 (40.00%), Postives = 22/30 (73.33%), Query Frame = 1
Query:    1 YIAGAKVKVECKDRKSMQVVYSREGKTDST 90
            Y+ GAKV +EC++R+   ++YS + +TD +
Sbjct:   49 YMKGAKVSLECRNREGGTLIYSSDSETDKS 78          
BLAST of CK740322 vs. ExPASy Swiss-Prot
Match: PHLB_PHLPR (Pollen allergen Phl p 11 OS=Phleum pratense PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.226e-13
Identity = 34/81 (41.98%), Postives = 49/81 (60.49%), Query Frame = 2
Query:   92 GTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSE-TRYANSMGFMKAEPMSGCAEVLRLYQEED 331
            G YKI + +DHQ+++C+ VL  SP   C  +   R+R+RV LTS NGI  +  RYAN + F + EP+  C  +L+ Y   D
Sbjct:   58 GWYKIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLKECGGILQAYDLRD 138          
BLAST of CK740322 vs. ExPASy Swiss-Prot
Match: PSC13_MAIZE (Pollen-specific protein C13 OS=Zea mays GN=MGS1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.387e-12
Identity = 38/106 (35.85%), Postives = 57/106 (53.77%), Query Frame = 2
Query:   32 AKTGSQCK*YIAGK------GKQTQPGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVLRLYQEED 331
            AK   +CK +  GK      G     GTY I + + H++ +C  VL++SP+ DC  V   R+R+ V+LT   GIS   R AN +G+ K  P+  CA +L+    +D
Sbjct:   61 AKVRLECKHFGTGKLERAIDGVTDATGTYTIELKDSHEEDICQVVLVASPRKDCDEVQALRDRAGVLLTRNVGISDSLRPANPLGYFKDVPLPVCAALLKQLDSDD 166          
BLAST of CK740322 vs. ExPASy Swiss-Prot
Match: LOLB_LOLPR (Major pollen allergen Lol p 11 OS=Lolium perenne PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.424e-12
Identity = 36/103 (34.95%), Postives = 55/103 (53.40%), Query Frame = 2
Query:   32 AKTGSQCK*YIAGKGK------QTQPGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSE-TRYANSMGFMKAEPMSGCAEVLRLY 319
            A     C+ +  G+ K        + G YKI + +DHQ+++C+ VL  SP   C  +   R+R+RV LTS  GI  +  RYAN + F + EP+  C  +L+ Y
Sbjct:   32 ATVAVDCRPFDGGESKLKAEATTDKDGWYKIEIDQDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLKECGGILQAY 134          
BLAST of CK740322 vs. ExPASy Swiss-Prot
Match: LAT52_SOLLC (Anther-specific protein LAT52 OS=Solanum lycopersicum GN=LAT52 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.546e-12
Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 2
Query:   71 KGKQTQPGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVL 310
            +G   + G YK+ V+ DH++ +C+  ++ SP+ DCK    G E++R+  +   GI +  R+AN + FMKAE + GC E L
Sbjct:   72 EGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEAL 151          
The following BLAST results are available for this feature:
BLAST of CK740322 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
OLEE1_BETVE6.866e-1541.56Olee1-like protein OS=Betula verrucosa PE=2 SV=1[more]
PHLB_PHLPR5.226e-1341.98Pollen allergen Phl p 11 OS=Phleum pratense PE=1 S... [more]
PSC13_MAIZE3.387e-1235.85Pollen-specific protein C13 OS=Zea mays GN=MGS1 PE... [more]
LOLB_LOLPR4.424e-1234.95Major pollen allergen Lol p 11 OS=Lolium perenne P... [more]
LAT52_SOLLC7.546e-1237.50Anther-specific protein LAT52 OS=Solanum lycopersi... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6466 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740322 ID=CK740322|Name=CK740322|organism=Citrus sinensis|type=EST|length=605bp
TACATCGCCGGTGCCAAGGTTAAGGTTGAATGCAAAGACAGGAAGTCAAT
GCAAGTAGTATATAGCAGGGAAGGGAAAACAGACTCAACCTGGAACATAT
AAGATCCTCGTTTCAGAAGACCATCAGGATCAACTTTGCGATGCTGTCCT
CATTAGTAGCCCCCAGAATGACTGCAAAACAGTTGCCCCAGGGCGTGAGC
GTTCCCGTGTGATCTTGACCAGTTACAACGGCATTTCTTCTGAAACCCGA
TATGCCAATTCAATGGGCTTCATGAAGGCAGAGCCCATGTCTGGCTGTGC
TGAGGTTCTCAGGCTATATCAGGAGGAGGATGTGTAGAGAATGGTGTGGC
ATGGTTTTTTCTATCGCTTTCCATTTGTTTAAGCTTTGTGTTGCCTTATA
CTGTCTCTTCTATTAGTAGTGCCCGGATGGCTGTGTTGTTTCTATGTTTA
GAGAATTCTTAATTTGTTGTTAAAGGACGCGTACGCTATTAATTTATTTA
TATGCTGGTGCTTCTAGCTTTGAGATGTGTTTTATCGCTAGTAATGCCTG
ATTTATTTTTGCAATAAATCTGTTCCAGCCTTTGAAGCTAAAAAAAAAAA
AAAAA
back to top