CK740325

Overview
NameCK740325
Unique NameCK740325
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length396
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK740325_ssr193 microsatellite CK740325_ssr193:193..204. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig12624 contig Csv1_Contig12624:52..446. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EIF3G_MOUSE (Eukaryotic translation initiation factor 3 subunit G OS=Mus musculus GN=Eif3g PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 2.377e-22
Identity = 44/79 (55.70%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  171 QLHQRLQPAAAGATK-GTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            +L   L+P  A  +K G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D
Sbjct:  195 KLPGELEPVQAAQSKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKD 273          

HSP 2 Score: 41.5874 bits (96), Expect = 2.377e-22
Identity = 16/31 (51.61%), Postives = 21/31 (67.74%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKDLAAPAE 154
            G  ++ CR C  KGDHWT+RCP+KD   P +
Sbjct:  151 GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQ 179          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EIF3G_RAT (Eukaryotic translation initiation factor 3 subunit G OS=Rattus norvegicus GN=Eif3g PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.093e-22
Identity = 44/79 (55.70%), Postives = 54/79 (68.35%), Query Frame = 3
Query:  171 QLHQRLQPAAAGATK-GTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            +L   L+P  A   K G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D
Sbjct:  195 KLPGELEPVQAAQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKD 273          

HSP 2 Score: 41.5874 bits (96), Expect = 3.093e-22
Identity = 16/31 (51.61%), Postives = 21/31 (67.74%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKDLAAPAE 154
            G  ++ CR C  KGDHWT+RCP+KD   P +
Sbjct:  151 GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQ 179          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EIF3G_HUMAN (Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens GN=EIF3G PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 5.235e-22
Identity = 44/79 (55.70%), Postives = 54/79 (68.35%), Query Frame = 3
Query:  171 QLHQRLQPAAAGATK-GTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            +L   L+P  A   K G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D
Sbjct:  195 KLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKD 273          

HSP 2 Score: 41.5874 bits (96), Expect = 5.235e-22
Identity = 16/31 (51.61%), Postives = 21/31 (67.74%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKDLAAPAE 154
            G  ++ CR C  KGDHWT+RCP+KD   P +
Sbjct:  151 GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQ 179          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EIF3G_BOVIN (Eukaryotic translation initiation factor 3 subunit G OS=Bos taurus GN=EIF3G PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.235e-22
Identity = 44/79 (55.70%), Postives = 54/79 (68.35%), Query Frame = 3
Query:  171 QLHQRLQPAAAGATK-GTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            +L   L+P  A   K G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D
Sbjct:  195 KLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKD 273          

HSP 2 Score: 41.5874 bits (96), Expect = 5.235e-22
Identity = 16/31 (51.61%), Postives = 21/31 (67.74%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKDLAAPAE 154
            G  ++ CR C  KGDHWT+RCP+KD   P +
Sbjct:  151 GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQ 179          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EI3GB_XENLA (Eukaryotic translation initiation factor 3 subunit G-B OS=Xenopus laevis GN=eif3g-B PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.817e-22
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  189 QPAAAGATK-GTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            +PA A  +K G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D
Sbjct:  189 EPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKD 261          

HSP 2 Score: 42.3578 bits (98), Expect = 6.817e-22
Identity = 18/43 (41.86%), Postives = 25/43 (58.14%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFIDKPAASETA 190
            G  ++ CR C  KGDHWT+RCP+KD   P +  + +     TA
Sbjct:  138 GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTA 178          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EIF3G_XENTR (Eukaryotic translation initiation factor 3 subunit G OS=Xenopus tropicalis GN=eif3g PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.154e-21
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  189 QPAAAGATK-GTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            +PA A  +K G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D
Sbjct:  191 EPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKD 263          

HSP 2 Score: 41.5874 bits (96), Expect = 1.154e-21
Identity = 16/31 (51.61%), Postives = 21/31 (67.74%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKDLAAPAE 154
            G  ++ CR C  KGDHWT+RCP+KD   P +
Sbjct:  140 GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQ 168          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EI3GA_XENLA (Eukaryotic translation initiation factor 3 subunit G-A OS=Xenopus laevis GN=eif3g-A PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.154e-21
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  189 QPAAAGATK-GTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            +PA A  +K G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D
Sbjct:  189 EPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKD 261          

HSP 2 Score: 41.5874 bits (96), Expect = 1.154e-21
Identity = 16/31 (51.61%), Postives = 21/31 (67.74%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKDLAAPAE 154
            G  ++ CR C  KGDHWT+RCP+KD   P +
Sbjct:  138 GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQ 166          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EIF3G_DANRE (Eukaryotic translation initiation factor 3 subunit G OS=Danio rerio GN=eif3g PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.232e-20
Identity = 38/63 (60.32%), Postives = 46/63 (73.02%), Query Frame = 3
Query:  216 GTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D
Sbjct:  184 GKYVPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKD 246          

HSP 2 Score: 41.5874 bits (96), Expect = 1.232e-20
Identity = 16/31 (51.61%), Postives = 21/31 (67.74%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKDLAAPAE 154
            G  ++ CR C  KGDHWT+RCP+KD   P +
Sbjct:  125 GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQ 153          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EIF3G_NEMVE (Eukaryotic translation initiation factor 3 subunit G OS=Nematostella vectensis GN=v1g171563 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.397e-18
Identity = 37/69 (53.62%), Postives = 49/69 (71.01%), Query Frame = 3
Query:  198 AAGATKGTYVPPGMRAGAERTGTHM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            AA +T G YV PG+R GA R G  M    +R++  ++RVTNLSE+TRE DL ELFRP G +SR+++A D
Sbjct:  178 AAASTSGKYVAPGLRDGANRRGETMPSRSQRDETATIRVTNLSEETRESDLQELFRPLGPISRIFLAKD 246          

HSP 2 Score: 38.1206 bits (87), Expect = 1.397e-18
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = 2
Query:   62 GAVLMVCRTCGKKGDHWTSRCPFKD 136
            G  ++ CR C  KGDHWT++CP+KD
Sbjct:  127 GQKIVQCRIC--KGDHWTTKCPYKD 149          
BLAST of CK740325 vs. ExPASy Swiss-Prot
Match: EIF3G_CHAGB (Eukaryotic translation initiation factor 3 subunit G OS=Chaetomium globosum GN=TIF35 PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.813e-15
Identity = 38/77 (49.35%), Postives = 49/77 (63.64%), Query Frame = 3
Query:  192 PAAAGAT----KGTYVPPGMRAGA-----ERTGTHMRRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVD 395
            PAAAGA     KG+YVPP MRAGA     ER G     R+D  ++RVTN+SE   E +L ++F  FG V+RV++A D
Sbjct:  181 PAAAGAAGAGKKGSYVPPAMRAGAGGAQGERMGGKYGERDDLATLRVTNVSEMAEEQELRDMFERFGRVTRVFLAKD 257          

HSP 2 Score: 35.8094 bits (81), Expect = 2.813e-15
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 2
Query:   80 CRTCGKKGDHWTSRCPFKDLAAP---------AETFIDKPAASETAA 193
            CR C   G+H+T+RCP+KD  AP         A    D+PAA+  AA
Sbjct:  139 CRICN--GEHFTARCPYKDTMAPIGEAGPADVAAGMGDEPAAAGPAA 183          
The following BLAST results are available for this feature:
BLAST of CK740325 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
EIF3G_MOUSE2.377e-2255.70Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_RAT3.093e-2255.70Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_HUMAN5.235e-2255.70Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_BOVIN5.235e-2255.70Eukaryotic translation initiation factor 3 subunit... [more]
EI3GB_XENLA6.817e-2257.53Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_XENTR1.154e-2157.53Eukaryotic translation initiation factor 3 subunit... [more]
EI3GA_XENLA1.154e-2157.53Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_DANRE1.232e-2060.32Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_NEMVE1.397e-1853.62Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_CHAGB2.813e-1549.35Eukaryotic translation initiation factor 3 subunit... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6469 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740325 ID=CK740325|Name=CK740325|organism=Citrus sinensis|type=EST|length=396bp
CCTCGTGCGCACGAGGGAGACAAAGGCTGCAGGAGATTCCTTGGCGCAAC
TTGGGAAAGGTGGTGCTGTTCTCATGGTGTGTAGGACTTGTGGTAAGAAG
GGTGATCACTGGACGTCAAGGTGCCCTTTCAAGGATCTTGCTGCTCCAGC
TGAGACATTCATTGATAAACCAGCTGCATCAGAGACTGCAGCCTGCTGCT
GCTGGCGCGACCAAGGGAACATATGTTCCTCCTGGCATGAGAGCAGGGGC
GGAGAGAACTGGAACCCATATGAGACGCAGGAATGATGAGAACTCTGTTA
GGGTCACCAACCTATCGGAGGACACTCGGGAACCTGACTTGCTTGAGCTC
TTCCGACCTTTTGGTGCTGTTAGCCGAGTTTATGTTGCTGTTGATC
back to top