CK740326

Overview
NameCK740326
Unique NameCK740326
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length463
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2264 contig Csv1_Contig2264:281..742. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBC2_MEDSA (Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.252e-65
Identity = 96/100 (96.00%), Postives = 100/100 (100.00%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSWTAD 384
            FKL+LQF+EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREY+RRVRE+VEQSWTAD
Sbjct:   53 FKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREVVEQSWTAD 152          

HSP 2 Score: 63.929 bits (154), Expect = 4.252e-65
Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAPQDN+IMLWNAVIFGPDDTPWDGGT
Sbjct:   26 GAPQDNNIMLWNAVIFGPDDTPWDGGT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBC2_ARATH (Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.603e-64
Identity = 95/100 (95.00%), Postives = 100/100 (100.00%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSWTAD 384
            FKL+LQF+EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSE+KREY+RRVRE+VEQSWTAD
Sbjct:   53 FKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSESKREYNRRVREVVEQSWTAD 152          

HSP 2 Score: 63.929 bits (154), Expect = 1.603e-64
Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAPQDN+IMLWNAVIFGPDDTPWDGGT
Sbjct:   26 GAPQDNNIMLWNAVIFGPDDTPWDGGT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBC2_WHEAT (Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.635e-64
Identity = 96/100 (96.00%), Postives = 100/100 (100.00%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSWTAD 384
            FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARM+SENKREY+R+VRE+VEQSWTAD
Sbjct:   53 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 152          

HSP 2 Score: 59.6918 bits (143), Expect = 4.635e-64
Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAP DN+I LWNAVIFGPDDTPWDGGT
Sbjct:   26 GAPHDNNITLWNAVIFGPDDTPWDGGT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBC1_ARATH (Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 7.881e-64
Identity = 93/100 (93.00%), Postives = 100/100 (100.00%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSWTAD 384
            FKL+LQF+EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARM+SE+KREY+RRVR++VEQSWTAD
Sbjct:   53 FKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD 152          

HSP 2 Score: 63.929 bits (154), Expect = 7.881e-64
Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAPQDN+IMLWNAVIFGPDDTPWDGGT
Sbjct:   26 GAPQDNNIMLWNAVIFGPDDTPWDGGT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBC3_ARATH (Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 7.745e-58
Identity = 87/97 (89.69%), Postives = 94/97 (96.91%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSW 375
            FKLTL FTEDYPNKPP VRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAA+LTSIQSLLCDPNP+SPAN+EAAR+FSENKREY+R+V EIVEQS+
Sbjct:   53 FKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAVLTSIQSLLCDPNPDSPANAEAARLFSENKREYNRKVIEIVEQSY 149          

HSP 2 Score: 58.5362 bits (140), Expect = 7.745e-58
Identity = 23/27 (85.19%), Postives = 26/27 (96.30%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAPQDN+IM WNA+IFGP+DTPWDGGT
Sbjct:   26 GAPQDNNIMHWNALIFGPEDTPWDGGT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBC2_DICDI (Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 4.084e-53
Identity = 81/99 (81.82%), Postives = 96/99 (96.97%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSWTA 381
            FKL+LQF+E+YPN  PTV+F+S+MFHPN+YADGSICLDILQNQWSPIYD+AAILTSIQSLLCDPNPNSPANSE+AR+F ENKREY+R+V+EIVEQSW++
Sbjct:   53 FKLSLQFSEEYPNDAPTVKFLSKMFHPNVYADGSICLDILQNQWSPIYDIAAILTSIQSLLCDPNPNSPANSESARLFRENKREYNRKVKEIVEQSWSS 151          

HSP 2 Score: 46.2098 bits (108), Expect = 4.084e-53
Identity = 17/27 (62.96%), Postives = 23/27 (85.19%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAP +N+I++W AVIFGPDD+ W+G T
Sbjct:   26 GAPLENNILMWQAVIFGPDDSIWEGAT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBE2A_MOUSE (Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.816e-50
Identity = 77/97 (79.38%), Postives = 91/97 (93.81%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSW 375
            FKLT++FTE+YPNKPPTVRFVS+MFHPN+YADGSICLDILQN+WSP YDV++ILTSIQSLL +PNPNSPANS+AA+++ ENKREY +RV  IVEQSW
Sbjct:   53 FKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149          

HSP 2 Score: 46.9802 bits (110), Expect = 1.816e-50
Identity = 18/27 (66.67%), Postives = 24/27 (88.89%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAP +N+IM+WNAVIFGP+ TP++ GT
Sbjct:   26 GAPSENNIMVWNAVIFGPEGTPFEDGT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBE2A_HUMAN (Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=2 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 1.816e-50
Identity = 77/97 (79.38%), Postives = 91/97 (93.81%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSW 375
            FKLT++FTE+YPNKPPTVRFVS+MFHPN+YADGSICLDILQN+WSP YDV++ILTSIQSLL +PNPNSPANS+AA+++ ENKREY +RV  IVEQSW
Sbjct:   53 FKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149          

HSP 2 Score: 46.9802 bits (110), Expect = 1.816e-50
Identity = 18/27 (66.67%), Postives = 24/27 (88.89%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAP +N+IM+WNAVIFGP+ TP++ GT
Sbjct:   26 GAPSENNIMVWNAVIFGPEGTPFEDGT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBCD6_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=UbcD6 PE=2 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 1.972e-49
Identity = 74/97 (76.29%), Postives = 89/97 (91.75%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSW 375
            FKLT++FTE+YPNKPPTVRFVS++FHPN+YADG ICLDILQN+WSP YDV+AILTSIQSLL DPNPNSPANS AA+++ EN+REY +RV+  VEQS+
Sbjct:   53 FKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSF 149          

HSP 2 Score: 50.0618 bits (118), Expect = 1.972e-49
Identity = 20/27 (74.07%), Postives = 24/27 (88.89%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAP DN+IM+WNAVIFGP DTP++ GT
Sbjct:   26 GAPTDNNIMIWNAVIFGPHDTPFEDGT 52          
BLAST of CK740326 vs. ExPASy Swiss-Prot
Match: UBE2B_RAT (Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 9.672e-49
Identity = 74/97 (76.29%), Postives = 90/97 (92.78%), Query Frame = 1
Query:   85 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYHRRVREIVEQSW 375
            FKL ++F+E+YPNKPPTVRF+S+MFHPN+YADGSICLDILQN+WSP YDV++ILTSIQSLL +PNPNSPANS+AA+++ ENKREY +RV  IVEQSW
Sbjct:   53 FKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149          

HSP 2 Score: 45.8246 bits (107), Expect = 9.672e-49
Identity = 18/27 (66.67%), Postives = 23/27 (85.19%), Query Frame = 3
Query:    3 GAPQDNSIMLWNAVIFGPDDTPWDGGT 83
            GAP +N+IM WNAVIFGP+ TP++ GT
Sbjct:   26 GAPSENNIMQWNAVIFGPEGTPFEDGT 52          
The following BLAST results are available for this feature:
BLAST of CK740326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 225
Match NameE-valueIdentityDescription
UBC2_MEDSA4.252e-6596.00Ubiquitin-conjugating enzyme E2 2 OS=Medicago sati... [more]
UBC2_ARATH1.603e-6495.00Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis t... [more]
UBC2_WHEAT4.635e-6496.00Ubiquitin-conjugating enzyme E2 2 OS=Triticum aest... [more]
UBC1_ARATH7.881e-6493.00Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis t... [more]
UBC3_ARATH7.745e-5889.69Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis t... [more]
UBC2_DICDI4.084e-5381.82Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium... [more]
UBE2A_MOUSE1.816e-5079.38Ubiquitin-conjugating enzyme E2 A OS=Mus musculus ... [more]
UBE2A_HUMAN1.816e-5079.38Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens ... [more]
UBCD6_DROME1.972e-4976.29Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UBE2B_RAT9.672e-4976.29Ubiquitin-conjugating enzyme E2 B OS=Rattus norveg... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6470 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740326 ID=CK740326|Name=CK740326|organism=Citrus sinensis|type=EST|length=463bp
GTGGTGCTCCTCAGGACAACAGTATAATGCTTTGGAATGCTGTTATATTC
GGGCCGGATGACACCCCATGGGATGGAGGTACCGTTTAAATTGACACTTC
AGTTCACAGAGGATTATCCAAATAAGCCACCAACAGTGCGCTTTGTTTCT
CGGATGTTCCATCCAAATATTTATGCGGATGGAAGCATTTGCTTGGACAT
TCTACAAAATCAGTGGAGTCCAATTTACGATGTAGCAGCAATACTCACGT
CAATTCAGTCATTGCTTTGTGACCCAAATCCAAACTCTCCTGCAAATTCG
GAGGCAGCACGGATGTTTAGCGAGAACAAGCGTGAATACCATAGGAGAGT
ACGGGAAATTGTTGAGCAGAGTTGGACTGCTGACTAGTGGCAACTTGTTG
GAATGTAGGGAACTTCAAAAATAGTCCAATGGCTTGTTCTAAATAACATT
TAAGATTCAAAAG
back to top