CK740329

Overview
NameCK740329
Unique NameCK740329
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length519
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1496 contig Csv1_Contig1496:466..984. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: A494_ARATH (Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2)

HSP 1 Score: 318.161 bits (814), Expect = 1.466e-86
Identity = 150/172 (87.21%), Postives = 163/172 (94.77%), Query Frame = 3
Query:    3 LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVL 518
            LP +FDWR++GAV PVK+QGSCGSCWSFSTTGALEGA+FLATGKLVSLSEQQLVDCDHECDPEE GSCDSGCNGGLMNSAFEYTLK GGLMRE+DYPYTGTD G +CK D+SKI ASV+NFSVVS++EDQIAANL+KNGPLAVAINA YMQTYIGGVSCPYICSRRL+HGVL
Sbjct:  132 LPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLSEQQLVDCDHECDPEEEGSCDSGCNGGLMNSAFEYTLKTGGLMREKDYPYTGTD-GGSCKLDRSKIVASVSNFSVVSINEDQIAANLIKNGPLAVAINAAYMQTYIGGVSCPYICSRRLNHGVL 302          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: RD19A_ARATH (Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 4.718e-85
Identity = 149/172 (86.63%), Postives = 158/172 (91.86%), Query Frame = 3
Query:    3 LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVL 518
            LP DFDWR+ GAV PVK+QGSCGSCWSFS TGALEGANFLATGKLVSLSEQQLVDCDHECDPEE  SCDSGCNGGLMNSAFEYTLK GGLM+EEDYPYTG D G  CK DKSKI ASV+NFSV+S+DE+QIAANLVKNGPLAVAINA YMQTYIGGVSCPYIC+RRL+HGVL
Sbjct:  135 LPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKD-GKTCKLDKSKIVASVSNFSVISIDEEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPYICTRRLNHGVL 305          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: CYSP_PEA (Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 1.329e-79
Identity = 139/173 (80.35%), Postives = 159/173 (91.91%), Query Frame = 3
Query:    3 LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSR-RLDHGVL 518
            LP DFDWREKGAV PVKDQGSCGSCW+FSTTGALEGA++LATGKLVSLSEQQLVDCDH CDPE+ GSCDSGCNGGLMN+AFEY L++GG+++E+DY YTG D   +CKFDKSK+ ASV+NFSVV+LDEDQIAANLVKNGPLAVAINA +MQTY+ GVSCPY+C++ RLDHGVL
Sbjct:  132 LPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYLATGKLVSLSEQQLVDCDHVCDPEQAGSCDSGCNGGLMNNAFEYLLESGGVVQEKDYAYTGRD--GSCKFDKSKVVASVSNFSVVTLDEDQIAANLVKNGPLAVAINAAWMQTYMSGVSCPYVCAKSRLDHGVL 302          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: CYSP1_MAIZE (Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.165e-75
Identity = 133/172 (77.33%), Postives = 146/172 (84.88%), Query Frame = 3
Query:    3 LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVL 518
            LP DFDWR+ GAVGPVK+QGSCGSCWSFS +GALEGA++LATGKL  LSEQQ VDCDHECD  EP SCDSGCNGGLM +AF Y  KAGGL  E+DYPYTG+D    CKFDKSKI ASV NFSVVS+DE QI+ANL+K+GPLA+ INA YMQTYIGGVSCPYIC R LDHGVL
Sbjct:  137 LPDDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLATGKLEVLSEQQFVDCDHECDSSEPDSCDSGCNGGLMTTAFSYLQKAGGLESEKDYPYTGSD--GKCKFDKSKIVASVQNFSVVSVDEAQISANLIKHGPLAIGINAAYMQTYIGGVSCPYICGRHLDHGVL 306          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: CYSP1_DICDI (Cysteine proteinase 1 OS=Dictyostelium discoideum GN=cprA PE=1 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 3.904e-47
Identity = 90/173 (52.02%), Postives = 117/173 (67.63%), Query Frame = 3
Query:    3 LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHEC-DPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVL 518
            +P  FDWR +GAV PVK+QG CGSCWSFSTTG +EG +F++  KLVSLSEQ LVDCDHEC + E   +CD GCNGGL  +A+ Y +K GG+  E  YPYT  + G  C F+ + I A ++NF+++  +E  +A  +V  GPLA+A +AV  Q YIGGV         LDHG+L
Sbjct:  118 IPTAFDWRTRGAVTPVKNQGQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGEQACDEGCNGGLQPNAYNYIIKNGGIQTESSYPYT-AETGTQCNFNSANIGAKISNFTMIPKNETVMAGYIVSTGPLAIAADAVEWQFYIGGVFDIPCNPNSLDHGIL 289          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: CYSP2_DICDI (Cysteine proteinase 2 OS=Dictyostelium discoideum GN=cprB PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 3.663e-37
Identity = 85/174 (48.85%), Postives = 109/174 (62.64%), Query Frame = 3
Query:    6 PADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVY--MQTYIGGVSCPYICS-RRLDHGVL 518
            P   DWR K AV P+KDQG CGSCWSFSTTG+ EGA+ L T KLVSLSEQ LVDC     PEE    + GC+GGLMN+AF+Y +K  G+  E  YPYT  + G  C F+KS I A++  +  ++   +    N  ++GP++VAI+A +   Q Y  G+     CS   LDHGVL
Sbjct:  124 PKSIDWRTKNAVTPIKDQGQCGSCWSFSTTGSTEGAHALKTKKLVSLSEQNLVDCS---GPEE----NFGCDGGLMNNAFDYIIKNKGIDTESSYPYT-AETGSTCLFNKSDIGATIKGYVNITAGSEISLENGAQHGPVSVAIDASHNSFQLYTSGIYYEPKCSPTELDHGVL 289          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: CATL_SCHMA (Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.818e-36
Identity = 82/175 (46.86%), Postives = 110/175 (62.86%), Query Frame = 3
Query:    3 LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPY--ICSR-RLDHGVL 518
            +P +FDWREKGAV  VK+QG CGSCW+FSTTG +E   F  TGKL+SLSEQQLVDCD           D GCNGGL ++A+E  +K GGLM E++YPY    +   C      +A  + +   ++ DE ++AA L  N  ++V +NA+ +Q Y  G+S P+   CS+  LDH VL
Sbjct:  105 IPKNFDWREKGAVTEVKNQGMCGSCWAFSTTGNVESQWFRKTGKLLSLSEQQLVDCD---------GLDDGCNGGLPSNAYESIIKMGGLMLEDNYPYDA--KNEKCHLKTDGVAVYINSSVNLTQDETELAAWLYHNSTISVGMNALLLQFYQHGISHPWWIFCSKYLLDHAVL 268          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: CYSP3_DICDI (Cysteine proteinase 3 OS=Dictyostelium discoideum GN=cprC PE=3 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 1.539e-35
Identity = 81/174 (46.55%), Postives = 103/174 (59.20%), Query Frame = 3
Query:    6 PADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVY--MQTYIGGVSCPYICSRR-LDHGVL 518
            P + DWREK AV PVKDQG CGSC+SFSTTG++EG   + TGKLVSLSEQ ++DC      E       GCNGGLM +AFEY +K  GL  EE YPY        CKF +  +AA + ++  +   ++    N +   P++VAI+A +   Q Y  GV     CS   LDHGVL
Sbjct:  122 PLNVDWREKDAVTPVKDQGQCGSCYSFSTTGSVEGVTAIKTGKLVSLSEQNILDCSSSFGNE-------GCNGGLMTNAFEYIIKNNGLNSEEQYPYE-MKVNDECKFQEGSVAAKITSYKEIEAGDENDLQNALLLNPVSVAIDASHNSFQLYTAGVYYEPACSSEDLDHGVL 287          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: CYSP_TRYBB (Cysteine proteinase OS=Trypanosoma brucei brucei PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.010e-35
Identity = 84/176 (47.73%), Postives = 109/176 (61.93%), Query Frame = 3
Query:    6 PADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKA--GGLMREEDYPY-TGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGV--SCPYICSRRLDHGVL 518
            PA  DWREKGAV PVK QG CGSCW+FST G +EG   +A   LVSLSEQ LV CD         + DSGCNGGLM++AF + + +  G +  E  YPY +G      C+ +  +I A++ +   +  DED IAA L +NGPLA+A++A     Y GG+  SC    S++LDHGVL
Sbjct:  127 PAAVDWREKGAVTPVKVQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVSCD---------TIDSGCNGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDHVDLPQDEDAIAAYLAENGPLAIAVDAESFMDYNGGILTSC---TSKQLDHGVL 290          
BLAST of CK740329 vs. ExPASy Swiss-Prot
Match: CATL1_RAT (Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 4.477e-35
Identity = 80/175 (45.71%), Postives = 104/175 (59.43%), Query Frame = 3
Query:    3 LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVY--MQTYIGGVSC-PYICSRRLDHGVL 518
            +P   DWREKG V PVK+QG CGSCW+FS +G LEG  FL TGKL+SLSEQ LVDC H+         + GCNGGLM+ AF+Y  + GGL  EE YPY   D   +CK+      A+   F  +   E  +   +   GP++VA++A +  +Q Y  G+   P   S+ LDHGVL
Sbjct:  114 IPKTVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHD-------QGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKD--GSCKYRAEYAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVL 279          
The following BLAST results are available for this feature:
BLAST of CK740329 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 154
Match NameE-valueIdentityDescription
A494_ARATH1.466e-8687.21Probable cysteine proteinase A494 OS=Arabidopsis t... [more]
RD19A_ARATH4.718e-8586.63Cysteine proteinase RD19a OS=Arabidopsis thaliana ... [more]
CYSP_PEA1.329e-7980.35Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1[more]
CYSP1_MAIZE1.165e-7577.33Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=... [more]
CYSP1_DICDI3.904e-4752.02Cysteine proteinase 1 OS=Dictyostelium discoideum ... [more]
CYSP2_DICDI3.663e-3748.85Cysteine proteinase 2 OS=Dictyostelium discoideum ... [more]
CATL_SCHMA1.818e-3646.86Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=... [more]
CYSP3_DICDI1.539e-3546.55Cysteine proteinase 3 OS=Dictyostelium discoideum ... [more]
CYSP_TRYBB2.010e-3547.73Cysteine proteinase OS=Trypanosoma brucei brucei P... [more]
CATL1_RAT4.477e-3545.71Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6473 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740329 ID=CK740329|Name=CK740329|organism=Citrus sinensis|type=EST|length=519bp
ATTTGCCGGCGGATTTTGATTGGAGAGAGAAGGGCGCTGTAGGCCCTGTT
AAAGATCAGGGTTCATGCGGATCATGCTGGAGTTTCAGTACAACAGGGGC
CTTGGAAGGTGCTAACTTCCTGGCAACTGGAAAGCTTGTGAGCCTCAGTG
AGCAACAGCTTGTGGATTGCGATCATGAGTGTGATCCTGAGGAACCAGGT
TCTTGTGATTCTGGATGCAATGGTGGGCTTATGAACAGTGCTTTTGAGTA
CACACTCAAGGCTGGTGGGCTTATGCGGGAGGAAGACTATCCTTACACCG
GCACTGATCGTGGCCACGCCTGCAAATTCGATAAGAGTAAGATTGCTGCC
TCAGTGGCCAACTTCAGTGTTGTCTCCCTTGATGAGGATCAAATTGCTGC
CAATCTTGTGAAAAATGGTCCCCTTGCAGTGGCCATCAATGCCGTGTACA
TGCAGACATACATTGGGGGAGTTTCCTGCCCATACATATGCTCGAGGCGA
TTGGACCATGGAGTGTTGC
back to top