CK740331

Overview
NameCK740331
Unique NameCK740331
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length631
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1509 contig Csv1_Contig1509:452..1080. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CY561_MOUSE (Cytochrome b561 OS=Mus musculus GN=Cyb561 PE=2 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 3.547e-16
Identity = 26/82 (31.71%), Postives = 43/82 (52.44%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIFSVA 428
            GF  F +PG S  LRS   P H+ FG  +++ +V  A +G  E L F   S  + +  E +L N   ++ + +G  V++ +A
Sbjct:  138 GFSFFLFPGASFSLRSRYRPQHIFFGATIFLFSVGTALLGLKEALLFKLGSKYSTFEPEGVLANVLGLLLVCFGVVVLYILA 219          

HSP 2 Score: 46.9802 bits (110), Expect = 3.547e-16
Identity = 21/41 (51.22%), Postives = 24/41 (58.54%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFL 199
            A F YH +    +LYSLHSW GI V  LY +QWL     FL
Sbjct:  103 AVFDYHKKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFL 143          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CY561_PIG (Cytochrome b561 OS=Sus scrofa GN=CYB561 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 7.786e-16
Identity = 27/79 (34.18%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIF 419
            G   F +PG S  LRS   P HV FG  +++L+V  A +G  E L F   +  + + SE +L N   ++ + +GA V++
Sbjct:  140 GLGFFLFPGASFSLRSRYRPQHVFFGAAIFLLSVGTALLGLKEALLFQLGTKYSAFESEGVLANVLGLLLVAFGAVVLY 218          

HSP 2 Score: 45.4394 bits (106), Expect = 7.786e-16
Identity = 21/41 (51.22%), Postives = 25/41 (60.98%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFL 199
            A F YH +  I +LYSLHSW GI V  L+  QWL  +  FL
Sbjct:  105 AVFDYHRKKGIADLYSLHSWCGILVFVLFLAQWLVGLGFFL 145          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CY561_PONAB (Cytochrome b561 OS=Pongo abelii GN=CYB561 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.887e-15
Identity = 25/79 (31.65%), Postives = 40/79 (50.63%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIF 419
            GF  F +PG S  LRS   P H+ FG  +++L+V  A +G  E L F      + +  E +L N   ++   +G  V++
Sbjct:  139 GFSFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFKLRDKYSAFEPEGVLANVLGLLLACFGGAVLY 217          

HSP 2 Score: 46.9802 bits (110), Expect = 2.887e-15
Identity = 21/41 (51.22%), Postives = 24/41 (58.54%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFL 199
            A F YH +    +LYSLHSW GI V  LY +QWL     FL
Sbjct:  104 AVFDYHRKEGYADLYSLHSWCGILVFVLYFVQWLVGFSFFL 144          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CY561_HUMAN (Cytochrome b561 OS=Homo sapiens GN=CYB561 PE=2 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 3.752e-15
Identity = 25/79 (31.65%), Postives = 40/79 (50.63%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIF 419
            GF  F +PG S  LRS   P H+ FG  +++L+V  A +G  E L F      + +  E +L N   ++   +G  V++
Sbjct:  139 GFSFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSAFEPEGVLANVLGLLLACFGGAVLY 217          

HSP 2 Score: 46.9802 bits (110), Expect = 3.752e-15
Identity = 21/41 (51.22%), Postives = 24/41 (58.54%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFL 199
            A F YH +    +LYSLHSW GI V  LY +QWL     FL
Sbjct:  104 AVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFL 144          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CY561_SHEEP (Cytochrome b561 OS=Ovis aries GN=CYB561 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.347e-14
Identity = 26/79 (32.91%), Postives = 41/79 (51.90%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIF 419
            GF  F +PG S  LRS   P HV FG  +++L+VA A +G  E L F   +  + +  E +L N   ++   +   V++
Sbjct:  140 GFSFFLFPGASFSLRSRYRPQHVFFGAAIFLLSVATALLGLKEALLFELGTKYSTFEPEGVLANVLGLLLAAFATVVLY 218          

HSP 2 Score: 43.8986 bits (102), Expect = 2.347e-14
Identity = 19/41 (46.34%), Postives = 25/41 (60.98%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFL 199
            A F++H +    +LYSLHSW GI V +L+  QWL     FL
Sbjct:  105 AVFEHHRKKGYADLYSLHSWCGILVFALFFAQWLVGFSFFL 145          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CY561_BOVIN (Cytochrome b561 OS=Bos taurus GN=CYB561 PE=1 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 3.050e-14
Identity = 25/79 (31.65%), Postives = 41/79 (51.90%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIF 419
            GF  F +PG S  LRS   P HV FG  +++L+VA A +G  E L F   +  + +  E +L N   ++   +   +++
Sbjct:  140 GFSFFLFPGASFSLRSRYRPQHVFFGAAIFLLSVATALLGLKEALLFELGTKYSMFEPEGVLANVLGLLLATFATVILY 218          

HSP 2 Score: 43.8986 bits (102), Expect = 3.050e-14
Identity = 19/41 (46.34%), Postives = 25/41 (60.98%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFL 199
            A F++H +    +LYSLHSW GI V +L+  QWL     FL
Sbjct:  105 AVFEHHRKKGYADLYSLHSWCGILVFALFFAQWLVGFSFFL 145          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CYBR1_XENTR (Cytochrome b reductase 1 OS=Xenopus tropicalis GN=cybrd1 PE=2 SV=2)

HSP 1 Score: 48.1358 bits (113), Expect = 1.461e-13
Identity = 27/84 (32.14%), Postives = 44/84 (52.38%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTF-LENSGLAKYGSEALLVNFTAVITILYGAFVIFSVAS 431
            G  I+  P     LR+  +P HV  GL ++   +A A +G  EKL F L+    +K   EA+ VN   +I +++G  V++ V +
Sbjct:  136 GVSIYLLPFARDTLRAALMPVHVYSGLLIFGTVIATALMGITEKLIFSLKEPPYSKMPPEAIFVNTFGLIILVFGGLVVWMVTT 219          

HSP 2 Score: 47.3654 bits (111), Expect = 1.461e-13
Identity = 20/42 (47.62%), Postives = 28/42 (66.67%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFLL 202
            A F +HN   I N+YSLHSW+G+ V+ LY +Q +  V  +LL
Sbjct:  101 AVFDFHNAKNIPNMYSLHSWIGLTVVILYALQLVLGVSIYLL 142          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CY561_XENLA (Cytochrome b561 OS=Xenopus laevis GN=cyb561 PE=2 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 9.159e-13
Identity = 24/79 (30.38%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIF 419
            GF +FF PG +   RS+  P H  FG  +++ ++A + +G  EK+     S  + + +E +LVN   V+ +++GA + +
Sbjct:  139 GFSLFFIPGVAFTYRSQFKPLHEFFGRALFLSSIATSLLGLTEKMF----SEYSSHPAEGILVNSLGVLLVVFGAVIAY 213          

HSP 2 Score: 43.5134 bits (101), Expect = 9.159e-13
Identity = 16/34 (47.06%), Postives = 23/34 (67.65%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWL 178
            A F+YH  +   ++YSLHSW GI   +LY +QW+
Sbjct:  104 AVFQYHQANGYPDMYSLHSWCGIVTFTLYILQWI 137          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CYBR1_RAT (Cytochrome b reductase 1 OS=Rattus norvegicus GN=Cybrd1 PE=2 SV=1)

HSP 1 Score: 46.595 bits (109), Expect = 1.996e-12
Identity = 25/82 (30.49%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTF-LENSGLAKYGSEALLVNFTAVITILYGAFVIFSV 425
            GF IF  P     LR+  +P HV  GL ++   +A   +G  EKL F L+N     +  E +  N   ++ +++GA + + V
Sbjct:  138 GFFIFLLPWAPPSLRAIVMPIHVYSGLLLFGTVIATVLMGVTEKLFFVLKNPSYHSFPPEGVFTNTLGLLILVFGALIFWIV 219          

HSP 2 Score: 45.0542 bits (105), Expect = 1.996e-12
Identity = 21/44 (47.73%), Postives = 27/44 (61.36%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFLLSW 208
            A F YHN   I ++YSLHSW+G+ V+ LY  Q +     FLL W
Sbjct:  103 AVFDYHNVRKIPHMYSLHSWVGLTVLILYIQQLVVGFFIFLLPW 146          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CYBR1_DANRE (Cytochrome b reductase 1 OS=Danio rerio GN=cybrd1 PE=2 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 2.005e-12
Identity = 25/80 (31.25%), Postives = 43/80 (53.75%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTF-LENSGLAKYGSEALLVNFTAVITILYGAFVIF 419
            G  ++  P     +R+  +P H+  GLF++I  +A A +G  EKL F L++        EA+LVN   ++   +GA V++
Sbjct:  136 GIAVYLIPVTPVRVRAALMPLHIYSGLFIFISVIAAALMGITEKLIFSLKSPAYKDSPPEAVLVNVLGLLIAAFGALVVW 215          

HSP 2 Score: 43.1282 bits (100), Expect = 2.005e-12
Identity = 18/42 (42.86%), Postives = 27/42 (64.29%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFLL 202
            A F +HN   I N+YSLHSW+G+A + LY  Q +  +  +L+
Sbjct:  101 AVFVFHNAKNIPNMYSLHSWVGLAAVVLYPSQIVLGIAVYLI 142          
The following BLAST results are available for this feature:
BLAST of CK740331 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
CY561_MOUSE3.547e-1631.71Cytochrome b561 OS=Mus musculus GN=Cyb561 PE=2 SV=... [more]
CY561_PIG7.786e-1634.18Cytochrome b561 OS=Sus scrofa GN=CYB561 PE=2 SV=1[more]
CY561_PONAB2.887e-1531.65Cytochrome b561 OS=Pongo abelii GN=CYB561 PE=2 SV=... [more]
CY561_HUMAN3.752e-1531.65Cytochrome b561 OS=Homo sapiens GN=CYB561 PE=2 SV=... [more]
CY561_SHEEP2.347e-1432.91Cytochrome b561 OS=Ovis aries GN=CYB561 PE=2 SV=1[more]
CY561_BOVIN3.050e-1431.65Cytochrome b561 OS=Bos taurus GN=CYB561 PE=1 SV=2[more]
CYBR1_XENTR1.461e-1332.14Cytochrome b reductase 1 OS=Xenopus tropicalis GN=... [more]
CY561_XENLA9.159e-1330.38Cytochrome b561 OS=Xenopus laevis GN=cyb561 PE=2 S... [more]
CYBR1_RAT1.996e-1230.49Cytochrome b reductase 1 OS=Rattus norvegicus GN=C... [more]
CYBR1_DANRE2.005e-1231.25Cytochrome b reductase 1 OS=Danio rerio GN=cybrd1 ... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6387 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE62H01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740331 ID=CK740331|Name=CK740331|organism=Citrus sinensis|type=EST|length=631bp
GAGAAAAGAAGTGAAGAAAGTGATACACCTTGTTCTCCATGCTATTGCGC
TTATACTGGGCATTATCGGCATCTATGCTGCTTTCAAATATCATAACGAG
AGCGCCATTGTCAATCTTTATAGCTTGCATTCTTGGCTTGGAATTGCCGT
AATTTCCCTTTATGGCATTCAGTGGTTATACCGGGTTTGTAATTTTCTTC
TATCCTGGAGGATCAACTGGACTAAGAAGTGAATCGCTTCCATGGCACGT
ACTATTCGGGCTGTTTGTGTACATTCTGGCTGTTGCCAATGCAGCCATCG
GGTTCCTGGAGAAGCTCACATTCCTGGAGAATTCAGGCCTTGCTAAATAT
GGCTCTGAGGCTTTGCTTGTCAACTTCACCGCTGTTATCACAATCTTATA
TGGAGCCTTTGTTATATTCTCTGTTGCTTCTCAGGGTCCGGCTGAGGATG
ACTACAGCTATTCAGCTATATAAATATGAGAACTGTGTATTATACACGTT
ATGCTGACTATTAAGTTAGTCATCGGCCTAATTCCTATGCAAAGCTAAAA
TGCGTTGTGTTATTTGTATGTAATTGTAGTCTTTGTTTGTAGACGTTTGA
AACGAGACCATCTTATCAATTACGGTGGGAG
back to top